StarFunc result for job id Q96P47

User Input

>input (875 residues)
MNFQAGGGQSPQQQQQLAGGPPQQFALSNSAAIRAEIQRFESVHPNIYAIYDLIERIEDL
ALQNQIREHVISIEDSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEE
SPEGGRFKKEIVVDGQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFL
RLCSFRNASEVPMVLVGTQDAISAANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVER
VFQDVAQKVVALRKKQQLAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYS
SSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNIFTSRKGADLDREKKAAECKVDS
IGSGRAIPIKQGILLKRSGKSLNKEWKKKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLL
RTTVKVPGKRLPRATPATAPGTSPRANGLSVERSNTQLGGGTGAPHSASSASLHSERPLS
SSAWAGPRPEGLHQRSCSVSSADQWSEATTSLPPGMQHPASGPAEVLSSSPKLDPPPSPH
SNRKKHRRKKSTGTPRPDGPSSATEEAEESFEFVVVSLTGQTWHFEASTAEERELWVQSV
QAQILASLQGCRSAKDKTRLGNQNAALAVQAVRTVRGNSFCIDCDAPNPDWASLNLGALM
CIECSGIHRHLGAHLSRVRSLDLDDWPPELLAVMTAMGNALANSVWEGALGGYSKPGPDA
CREEKERWIRAKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNET
YGDGDGRTALHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQ
HGCPGEGCGLAPTPNREPANGTNPSAELHRSPSLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPQ3	0.291	0.297	0.000	857	0.698	0.713	Q9UPQ3.pdb.gz	AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4
2	AFDB:A0JMI1	0.330	0.346	8.568E-83	827	0.461	0.487	A0JMI1.pdb.gz	A0JMI1_DANRE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Danio rerio OX=7955 GN=agap2 PE=2 SV=1
3	AFDB:F8VVT9	0.277	0.217	4.276E-76	1192	0.497	0.365	F8VVT9.pdb.gz	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
4	PDB:3lvqE	0.198	0.382	8.218E-14	420	0.085	0.176	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
5	AFDB:A1Z7A6	0.213	0.166	1.693E-13	1155	0.120	0.091	A1Z7A6.pdb.gz	ASAP_DROME ArfGAP with SH3 domain, ANK repeat and PH domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Asap PE=1 SV=1
6	AFDB:A0A140LH27	0.150	0.083	1.538E-11	1664	0.152	0.080	A0A140LH27.pdb.gz	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
7	PDB:7sd0B	0.177	0.824	2.977E-11	174	0.049	0.247	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
8	PDB:7e1tB	0.172	0.812	4.722E-11	174	0.049	0.247	7e1tB.pdb.gz	Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.
9	PDB:1vg8A	0.179	0.793	7.882E-11	184	0.048	0.228	1vg8A.pdb.gz	Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease
10	PDB:3t5gA	0.170	0.797	8.297E-11	171	0.046	0.234	3t5gA.pdb.gz	Arl2-GTP and Arl3-GTP regulate a GDI-like transport system for farnesylated cargo.
11	PDB:6zizA	0.177	0.834	9.192E-11	170	0.051	0.265	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
12	PDB:6kykC	0.176	0.857	1.072E-10	169	0.043	0.225	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
13	PDB:2bovA	0.182	0.870	1.128E-10	173	0.048	0.243	2bovA.pdb.gz	Molecular Recognition of an Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme by Rala Gtpase
14	PDB:6zqtA	0.174	0.821	2.312E-10	173	0.048	0.243	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
15	PDB:2f9mA	0.180	0.809	3.309E-10	182	0.040	0.192	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
16	AFDB:Q54T92	0.181	0.077	5.573E-9	2107	0.077	0.032	Q54T92.pdb.gz	Q54T92_DICDI Rab GTPase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=comB PE=4 SV=1
17	AFDB:P97393	0.160	0.099	3.918E-7	1501	0.115	0.067	P97393.pdb.gz	RHG05_MOUSE Rho GTPase-activating protein 5 OS=Mus musculus OX=10090 GN=Arhgap5 PE=1 SV=3
18	AFDB:Q6IDD9	0.110	0.075	7.725E-3	1360	0.087	0.056	Q6IDD9.pdb.gz	SARM1_DROME NAD(+) hydrolase sarm1 OS=Drosophila melanogaster OX=7227 GN=Sarm PE=1 SV=1
19	AFDB:Q5H9F3	0.094	0.049	9.512E-2	1711	0.106	0.054	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
20	AFDB:Q8CGN4	0.100	0.050	2.052E-1	1759	0.103	0.051	Q8CGN4.pdb.gz	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JMI1	0.0	743	827	0.459	0.486	A0JMI1_DANRE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Danio rerio OX=7955 GN=agap2 PE=2 SV=1
2	F8VVT9	0.0	761	1192	0.475	0.349	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
3	J3KNM6	0.0	769	1036	0.475	0.402	J3KNM6_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
4	Q3UHD9	0.0	748	1186	0.477	0.352	AGAP2_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Agap2 PE=1 SV=1
5	Q8CGU4	0.0	753	1186	0.478	0.352	AGAP2_RAT Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Agap2 PE=1 SV=1
6	Q8VHH5	0.0	1720	910	0.970	0.933	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1
7	Q99490	0.0	761	1192	0.475	0.349	AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=2
8	Q9NGC3	0.0	738	995	0.493	0.433	CEG1A_DROME Centaurin-gamma-1A OS=Drosophila melanogaster OX=7227 GN=CenG1A PE=2 SV=2
9	Q9UPQ3	0.0	1234	857	0.695	0.709	AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4
10	U6A022	0.0	637	808	0.354	0.384	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
11	Q9XX14	7.17e-89	307	1107	0.234	0.185	CNT2_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 OS=Caenorhabditis elegans OX=6239 GN=cnt-2 PE=1 SV=2
12	Q54WI0	1.91e-40	164	1333	0.126	0.083	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
13	Q4QQN0	1.79e-35	145	626	0.096	0.134	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
14	Q3UH98	5.91e-35	145	833	0.096	0.101	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
15	A2ADA6	6.10e-35	145	829	0.096	0.101	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
16	Q6NXL5	6.18e-35	145	833	0.096	0.101	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
17	Q15027	1.73e-34	143	740	0.090	0.107	ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1
18	Q5W7F2	8.30e-34	142	827	0.114	0.121	AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana OX=3702 GN=AGD3 PE=1 SV=1
19	Q14161	4.37e-33	139	759	0.089	0.103	GIT2_HUMAN ARF GTPase-activating protein GIT2 OS=Homo sapiens OX=9606 GN=GIT2 PE=1 SV=2
20	Q9JLQ2	7.08e-33	138	708	0.089	0.110	GIT2_MOUSE ARF GTPase-activating protein GIT2 OS=Mus musculus OX=10090 GN=Git2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.51	22.1	Ankyrin repeat
2	PF12796 Ank_2	0.0049	28.7	Ankyrin repeats (3 copies)
3	PF13637 Ank_4	0.061	25.2	Ankyrin repeats (many copies)
4	PF13857 Ank_5	21	16.8	Ankyrin repeats (many copies)
5	PF01412 ArfGap	7e-33	124.6	Putative GTPase activating protein for Arf
6	PF15565 Imm30	7e+02	11.7	Immunity protein 30
7	PF00169 PH	2.6e-08	45.7	PH domain
8	PF15413 PH_11	3.4e+02	13.1	Pleckstrin homology domain
9	PF15406 PH_6	30	16.3	Pleckstrin homology domain
10	PF00071 Ras	3.2e-13	61.1	Ras family
11	PF08477 Roc	25	16.5	Ras of Complex, Roc, domain of DAPkinase
12	PF05621 TniB	4.8e+02	11.5	Bacterial TniB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000034042

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000023095	0.637	Erythrocyte membrane protein band 4.1-like 1
2	9598.ENSPTRP00000042008	0.566	Unc-5 homolog B (C. elegans)
3	9598.ENSPTRP00000025092	0.558	SH3 and multiple ankyrin repeat domains 3
4	9598.ENSPTRP00000031615	0.556	Tyrosine-protein kinase
5	9598.ENSPTRP00000026912	0.524	Phosphoinositide-3-kinase, catalytic, alpha polypeptide
6	9598.ENSPTRP00000029009	0.521	Phosphoinositide-3-kinase, regulatory subunit 1 (Alpha)
7	9598.ENSPTRP00000040371	0.516	Neurotrophic tyrosine kinase, receptor, type 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0016462	0.993	pyrophosphatase activity
GO:0003924	0.960	GTPase activity
GO:0140030	0.806	modification-dependent protein binding
GO:0031593	0.783	polyubiquitin modification-dependent protein binding
GO:0005543	0.750	phospholipid binding
GO:0098772	0.694	molecular function regulator activity
GO:0030234	0.543	enzyme regulator activity
GO:0043168	0.527	anion binding
GO:0019899	0.463	enzyme binding
GO:0008047	0.384	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050896	0.613	response to stimulus
GO:0051179	0.599	localization
GO:0065007	0.582	biological regulation
GO:0051716	0.359	cellular response to stimulus
GO:0050789	0.336	regulation of biological process
GO:0051234	0.325	establishment of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.997	nucleus
GO:0071944	0.978	cell periphery
GO:0005886	0.910	plasma membrane
GO:0005829	0.717	cytosol
GO:0030054	0.485	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.993	In phosphorus-containing anhydrides.
RHEA:19669	0.960	GTP + H2O = GDP + H(+) + phosphate

[back to server]