StarFunc result for job id Q96P48

User Input

>input (1450 residues)
MAEAGDAALSVAEWLRALHLEQYTGLFEQHGLVWATECQGLSDTRLMDMGMLLPGHRRRI
LAGLLRAHTSPAPAPRPTPRPVPMKRHIFRSPPVPATPPEPLPTTTEDEGLPAAPPIPPR
RSCLPPTCFTTPSTAAPDPVLPPLPAKRHLAELSVPPVPPRTGPPRLLVSLPTKEEESLL
PSLSSPPQPQSEEPLSTLPQGPPQPPSPPPCPPEIPPKPVRLFPEFDDSDYDEVPEEGPG
APARVMTKKEEPPPSRVPRAVRVASLLSEGEELSGDDQGDEEEDDHAYEGVPNGGWHTSS
LSLSLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYF
DSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERKEWMQALQQAMAE
QRARARLSSAYLLGVPGSEQPDRAGSLELRGFKNKLYVAVVGDKVQLYKNLEEYHLGIGI
TFIDMSVGNVKEVDRRSFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTSEVAER
IWAAAPNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTET
LIELFLQLGNGAGNRFWAANVPPSEALQPSSSPSTRRCHLEAKYREGKYRRYHPLFGNQE
ELDKALCAAVTTTDLAETQALLGCGAGINCFSGDPEAPTPLALAEQAGQTLQMEFLRNNR
TTEVPRLDSMKPLEKHYSVVLPTVSHSGFLYKTASAGKLLQDRRAREEFSRRWCVLGDGV
LSYFENERAVTPNGEIRASEIVCLAVPPPDTHGFEHTFEVYTEGERLYLFGLESAEQAHE
WVKCIAKAFVPPLAEDLLARDFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPC
EEPLQLRKLQELSIQGDSENQVLVLVERRRTLYIQGERRLDFMGWLGAIQKAAASMGDTL
SEQQLGDSDIPVIVYRCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEG
EQHVDDVSSALKRFLRDLPDGLFTRAQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRA
TVKALISHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFS
VDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTVYLEEKKAETEQHIKVPASMTAE
ELTLEILDRRNVGIREKDYWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVVKKHQ
AMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEVRSQ
RPWSGAPETSHRPEKEWPIKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDT
QMELREWFATFLFVQHDGLVWPSEPSRVSRAVPEVRLGSVSLIPLRGSENEMRRSVAAFT
ADPLSLLRNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LM60	0.528	0.530	0.000	1443	0.892	0.896	F1LM60.pdb.gz	F1LM60_RAT ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 OS=Rattus norvegicus OX=10116 GN=Arap1 PE=1 SV=1
2	AFDB:Q96P48	1.000	1.000	0.000	1450	1.000	1.000	Q96P48.pdb.gz	ARAP1_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARAP1 PE=1 SV=3
3	AFDB:Q8WZ64	0.308	0.266	1.298E-97	1704	0.371	0.316	Q8WZ64.pdb.gz	ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARAP2 PE=1 SV=3
4	AFDB:A0A140LH27	0.300	0.265	2.216E-92	1664	0.365	0.318	A0A140LH27.pdb.gz	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
5	AFDB:Q8WWN8	0.373	0.354	3.151E-89	1544	0.350	0.328	Q8WWN8.pdb.gz	ARAP3_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ARAP3 PE=1 SV=1
6	AFDB:Q8R5G7	0.302	0.286	1.794E-87	1538	0.339	0.320	Q8R5G7.pdb.gz	ARAP3_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arap3 PE=1 SV=3
7	PDB:5jcpA	0.135	0.536	2.790E-14	361	0.057	0.230	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
8	PDB:3ljuX	0.090	0.304	4.895E-13	373	0.058	0.225	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
9	AFDB:X2JC00	0.124	0.127	6.056E-13	1404	0.123	0.127	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
10	AFDB:Q9P227	0.127	0.123	3.541E-12	1491	0.134	0.130	Q9P227.pdb.gz	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
11	AFDB:P34288	0.129	0.117	2.947E-11	1605	0.129	0.117	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
12	AFDB:A0A1D8PLJ2	0.112	0.141	2.517E-8	1141	0.099	0.125	A0A1D8PLJ2.pdb.gz	A0A1D8PLJ2_CANAL Bem3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BEM3 PE=4 SV=1
13	PDB:3cxlA	0.114	0.397	6.104E-8	402	0.039	0.139	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
14	PDB:5c2kA	0.120	0.433	8.355E-8	382	0.048	0.181	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
15	PDB:1xa6A	0.115	0.404	1.649E-6	399	0.037	0.135	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
16	PDB:3lvqE	0.110	0.353	1.784E-6	420	0.037	0.129	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
17	PDB:6r3vA	0.108	0.726	2.347E-6	198	0.032	0.237	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
18	PDB:6u3eA	0.066	0.219	4.338E-4	397	0.027	0.098	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
19	PDB:7c3mA	0.056	0.133	6.423E-4	577	0.018	0.045	7c3mA.pdb.gz
20	PDB:7nkyQ	0.071	0.210	9.143E-4	404	0.022	0.079	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140LH27	0.0	836	1664	0.332	0.290	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
2	A0A8I6AQA1	0.0	2394	1454	0.886	0.884	A0A8I6AQA1_RAT ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 OS=Rattus norvegicus OX=10116 GN=Arap1 PE=1 SV=1
3	E7EU13	0.0	2459	1194	0.823	1.000	E7EU13_HUMAN ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 OS=Homo sapiens OX=9606 GN=ARAP1 PE=1 SV=1
4	F1LM60	0.0	2365	1443	0.879	0.883	F1LM60_RAT ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 OS=Rattus norvegicus OX=10116 GN=Arap1 PE=1 SV=1
5	Q8R5G7	0.0	688	1538	0.292	0.276	ARAP3_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arap3 PE=1 SV=3
6	Q8WWN8	0.0	679	1544	0.297	0.279	ARAP3_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ARAP3 PE=1 SV=1
7	Q8WZ64	0.0	877	1704	0.323	0.275	ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARAP2 PE=1 SV=3
8	Q96P48	0.0	2977	1450	1.000	1.000	ARAP1_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARAP1 PE=1 SV=3
9	Q0KHR5	5.30e-37	155	1510	0.090	0.087	Q0KHR5_DROME Rho GTPase activating protein at 15B, isoform B OS=Drosophila melanogaster OX=7227 GN=RhoGAP15B PE=1 SV=1
10	Q9VX92	5.46e-37	155	1552	0.090	0.084	Q9VX92_DROME Rho GTPase activating protein at 15B, isoform C OS=Drosophila melanogaster OX=7227 GN=RhoGAP15B PE=1 SV=3
11	Q8T3K2	8.27e-37	154	1226	0.090	0.107	Q8T3K2_DROME SD08167p OS=Drosophila melanogaster OX=7227 GN=RhoGAP15B PE=2 SV=1
12	H2KZV4	1.15e-24	114	1003	0.057	0.083	H2KZV4_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F23H11.4 PE=1 SV=1
13	Q9P227	8.01e-22	105	1491	0.044	0.043	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
14	J3KNM6	2.26e-21	103	1036	0.050	0.070	J3KNM6_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
15	Q4QQN0	2.62e-21	102	626	0.048	0.112	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
16	Q3UH98	3.80e-21	102	833	0.048	0.084	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
17	Q6NXL5	3.83e-21	102	833	0.048	0.084	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
18	A2ADA6	4.22e-21	102	829	0.048	0.084	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
19	Q91YM2	6.01e-21	102	1499	0.038	0.037	RHG35_MOUSE Rho GTPase-activating protein 35 OS=Mus musculus OX=10090 GN=Arhgap35 PE=1 SV=3
20	Q6TLK4	6.94e-21	102	869	0.077	0.128	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01412 ArfGap	7e-28	108.5	Putative GTPase activating protein for Arf
2	PF12814 Mcp5_PH	5.7e+02	12.1	Meiotic cell cortex C-terminal pleckstrin homology
3	PF00169 PH	8.6e-43	156.5	PH domain
4	PF15413 PH_11	3.8e-08	45.1	Pleckstrin homology domain
5	PF16652 PH_13	0.094	24.1	Pleckstrin homology domain
6	PF08458 PH_2	0.067	24.9	Plant pleckstrin homology-like region
7	PF15406 PH_6	0.00037	32.1	Pleckstrin homology domain
8	PF15409 PH_8	0.00031	32.3	Pleckstrin homology domain
9	PF00788 RA	1.9e-09	49.4	Ras association (RalGDS/AF-6) domain
10	PF00620 RhoGAP	1.1e-41	153.6	RhoGAP domain
11	PF00536 SAM_1	2e-07	42.6	SAM domain (Sterile alpha motif)
12	PF07647 SAM_2	7.5e-07	40.5	SAM domain (Sterile alpha motif)
13	PF13848 Thioredoxin_6	2.6e+02	12.8	Thioredoxin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377233

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380921	0.980	SH3 domain-containing kinase-binding protein 1
2	9606.ENSP00000440005	0.947	ADP-ribosylation factor 1
3	9606.ENSP00000400175	0.930	Transforming protein RhoA
4	9606.ENSP00000357048	0.925	Coatomer subunit alpha
5	9606.ENSP00000358723	0.924	Ras-related protein Rap-1A
6	9606.ENSP00000250559	0.922	Ras-related protein Rap-1b
7	9606.ENSP00000348461	0.922	Ras-related C3 botulinum toxin substrate 1
8	9606.ENSP00000407586	0.914	GTPase HRas
9	9606.ENSP00000309415	0.909	Clathrin light chain B
10	9606.ENSP00000242285	0.906	Clathrin light chain A
11	9606.ENSP00000258739	0.904	ER lumen protein-retaining receptor 2
12	9606.ENSP00000329471	0.904	ER lumen protein-retaining receptor 1
13	9606.ENSP00000386918	0.904	ER lumen protein-retaining receptor 3
14	9606.ENSP00000442460	0.843	Protein-tyrosine kinase 6
15	9606.ENSP00000376345	0.773	Growth factor receptor-bound protein 2
16	9606.ENSP00000357564	0.768	Ras-related protein Rab-13
17	9606.ENSP00000319713	0.758	Type-1 angiotensin II receptor-associated protein
18	9606.ENSP00000419422	0.726	Type-1 angiotensin II receptor
19	9606.ENSP00000234313	0.666	Pleckstrin
20	9606.ENSP00000257068	0.661	Melatonin receptor type 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	1.000	GTPase activator activity
GO:0005102	0.998	signaling receptor binding
GO:0001664	0.985	G protein-coupled receptor binding
GO:0043167	0.976	ion binding
GO:0005547	0.972	phosphatidylinositol-3,4,5-trisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048518	0.960	positive regulation of biological process
GO:0048522	0.938	positive regulation of cellular process
GO:0023051	0.928	regulation of signaling
GO:0009987	0.861	cellular process
GO:0019222	0.691	regulation of metabolic process
GO:0031323	0.617	regulation of cellular metabolic process
GO:0060255	0.612	regulation of macromolecule metabolic process
GO:0050896	0.489	response to stimulus
GO:0048519	0.478	negative regulation of biological process
GO:0048523	0.471	negative regulation of cellular process
GO:0051716	0.424	cellular response to stimulus
GO:0048583	0.398	regulation of response to stimulus
GO:0023052	0.397	signaling
GO:0007154	0.397	cell communication
GO:0031325	0.392	positive regulation of cellular metabolic process
GO:0007165	0.382	signal transduction
GO:0010604	0.379	positive regulation of macromolecule metabolic process
GO:0065009	0.358	regulation of molecular function
GO:0071840	0.344	cellular component organization or biogenesis
GO:0016043	0.321	cellular component organization
GO:0009966	0.300	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005794	0.998	Golgi apparatus
GO:0070013	0.988	intracellular organelle lumen
GO:0031981	0.984	nuclear lumen
GO:0031984	0.982	organelle subcompartment
GO:0005829	0.976	cytosol
GO:0005654	0.974	nucleoplasm
GO:0031982	0.849	vesicle
GO:0031410	0.760	cytoplasmic vesicle
GO:0005802	0.466	trans-Golgi network

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]