StarFunc result for job id Q96P50

User Input

>input (834 residues)
MTVEFEECVKDSPRFRATIDEVETDVVEIEAKLDKLVKLCSGMVEAGKAYVSTSRLFVSG
VRDLSQQCQGDTVISECLQRFADSLQEVVNYHMILFDQAQRSVRQQLQSFVKEDVRKFKE
TKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGALTLTRKCFRHLALDYVLQINVLQA
KKKFEILDSMLSFMHAQSSFFQQGYSLLHQLDPYMKKLAAELDQLVIDSAVEKREMERKH
AAIQQRTLLQDFSYDESKVEFDVDAPSGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVY
QKKLKDALTVVVDDLRLCSVKPCEDIERRFCFEVLSPTKSCMLQADSEKLRQAWVQAVQA
SIASAYRESPDSCYSERLDRTASPSTSSIDSATDTRERGVKGESVLQRVQSVAGNSQCGD
CGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSAVN
QIYEAQCEGAGSRKPTASSSRQDKEAWIKDKYVEKKFLRKAPMAPALEAPRRWRVQKCLR
PHSSPRAPTARRKVRLEPVLPCVAALSSVGTLDRKFRRDSLFCPDELDSLFSYFDAGAAG
AGPRSLSSDSGLGGSSDGSSDVLAFGSGSVVDSVTEEEGAESEESSGEADGDTEAEAWGL
ADVRELHPGLLAHRAARARDLPALAAALAHGAEVNWADAEDEGKTPLVQAVLGGSLIVCE
FLLQNGADVNQRDSRGRAPLHHATLLGRTGQVCLFLKRGADQHALDQEQRDPLAIAVQAA
NADIVTLLRLARMAEEMREAEAAPGPPGALAGSPTELQFRRCIQEFISLHLEES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UH98	0.738	0.739	0.000	833	0.936	0.938	Q3UH98.pdb.gz	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
2	AFDB:Q15057	0.699	0.745	3.359E-75	778	0.580	0.622	Q15057.pdb.gz	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
3	AFDB:Q15027	0.598	0.660	3.379E-60	740	0.466	0.526	Q15027.pdb.gz	ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1
4	AFDB:Q9VCQ6	0.667	0.672	5.765E-53	828	0.349	0.351	Q9VCQ6.pdb.gz	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
5	AFDB:Q9XXH8	0.385	0.388	4.634E-45	826	0.297	0.300	Q9XXH8.pdb.gz	CNT1_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 OS=Caenorhabditis elegans OX=6239 GN=cnt-1 PE=1 SV=2
6	AFDB:Q551Q8	0.401	0.397	2.002E-40	843	0.261	0.259	Q551Q8.pdb.gz	Q551Q8_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276395 PE=4 SV=1
7	AFDB:Q9FIT8	0.382	0.385	1.232E-36	828	0.251	0.252	Q9FIT8.pdb.gz	AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana OX=3702 GN=AGD1 PE=2 SV=2
8	AFDB:O43150	0.340	0.288	1.035E-28	1006	0.204	0.169	O43150.pdb.gz	ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2 PE=1 SV=3
9	AFDB:U6A022	0.215	0.221	5.348E-19	808	0.149	0.153	U6A022.pdb.gz	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
10	AFDB:F8VVT9	0.233	0.167	7.297E-17	1192	0.145	0.102	F8VVT9.pdb.gz	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
11	PDB:3lvqE	0.275	0.532	1.340E-11	420	0.107	0.212	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
12	PDB:3ljuX	0.130	0.287	1.175E-7	373	0.053	0.118	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
13	PDB:4mt6A	0.111	0.227	6.612E-6	389	0.059	0.126	4mt6A.pdb.gz
14	PDB:8cs9A	0.140	0.147	2.285E-5	796	0.047	0.049	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
15	PDB:6jd6B	0.140	0.580	2.851E-5	192	0.042	0.182	6jd6B.pdb.gz
16	PDB:3o47A	0.102	0.281	3.719E-5	289	0.046	0.131	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
17	PDB:1bd8A	0.134	0.650	4.248E-5	156	0.049	0.263	1bd8A.pdb.gz
18	PDB:4oauC	0.141	0.169	6.328E-5	692	0.042	0.051	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
19	PDB:3ehqA	0.133	0.589	7.227E-5	182	0.042	0.192	3ehqA.pdb.gz
20	PDB:4mk0A	0.112	0.145	7.555E-5	631	0.040	0.052	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2ADA6	0.0	1498	829	0.928	0.934	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
2	Q15057	0.0	955	778	0.578	0.620	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
3	Q3UH98	0.0	1510	833	0.932	0.933	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
4	Q4QQN0	0.0	1118	626	0.647	0.863	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
5	Q5FVC7	0.0	933	770	0.561	0.608	ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Acap2 PE=1 SV=1
6	Q6NXL5	0.0	1511	833	0.933	0.934	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
7	Q6ZQK5	0.0	804	770	0.524	0.568	ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Acap2 PE=1 SV=2
8	Q15027	2.52e-178	533	740	0.345	0.389	ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1
9	Q9VCQ6	6.26e-167	506	828	0.365	0.367	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
10	Q8T0R1	3.71e-164	497	767	0.360	0.391	Q8T0R1_DROME GH12888p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
11	Q8C8T5	9.19e-109	334	215	0.231	0.898	Q8C8T5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
12	Q9XXH8	4.13e-104	342	826	0.309	0.312	CNT1_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 OS=Caenorhabditis elegans OX=6239 GN=cnt-1 PE=1 SV=2
13	Q7KS50	1.45e-100	326	598	0.253	0.353	Q7KS50_DROME Centaurin beta 1A, isoform B OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
14	Q8MSZ5	1.73e-59	204	235	0.128	0.455	Q8MSZ5_DROME GM06875p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
15	Q5W7F2	3.74e-51	195	827	0.209	0.210	AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana OX=3702 GN=AGD3 PE=1 SV=1
16	Q54WI0	5.06e-49	190	1333	0.182	0.114	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
17	Q9FIT8	1.29e-48	187	828	0.205	0.207	AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana OX=3702 GN=AGD1 PE=2 SV=2
18	Q8TDY4	2.60e-48	187	903	0.179	0.165	ASAP3_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ASAP3 PE=1 SV=1
19	Q551Q8	1.15e-45	178	843	0.134	0.133	Q551Q8_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276395 PE=4 SV=1
20	O43150	1.88e-45	179	1006	0.170	0.141	ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.0071	27.9	Ankyrin repeat
2	PF12796 Ank_2	1.2e-06	40.3	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.0001	33.3	Ankyrin repeat
4	PF13637 Ank_4	0.00018	33.3	Ankyrin repeats (many copies)
5	PF13857 Ank_5	5.4e-08	44.2	Ankyrin repeats (many copies)
6	PF01412 ArfGap	9e-37	137.1	Putative GTPase activating protein for Arf
7	PF03114 BAR	25	16.0	BAR domain
8	PF16746 BAR_3	7.2e-86	299.2	BAR domain of APPL family
9	PF02601 Exonuc_VII_L	1.4e+02	13.5	Exonuclease VII, large subunit
10	PF00169 PH	1.5e-10	52.9	PH domain
11	PF15413 PH_11	54	15.7	Pleckstrin homology domain
12	PF15409 PH_8	2.2e+02	13.5	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346733

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368411	0.655	Amiloride-sensitive sodium channel subunit delta
2	9606.ENSP00000268483	0.639	Thioredoxin-like protein 4B
3	9606.ENSP00000361577	0.611	Leucine-rich melanocyte differentiation-associated protein
4	9606.ENSP00000363349	0.542	Sorting nexin-30
5	9606.ENSP00000329795	0.517	Transmembrane protein 105
6	9606.ENSP00000350018	0.503	SH3 domain-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	1.000	GTPase activator activity
GO:0005488	0.996	binding
GO:0005515	0.994	protein binding
GO:0008289	0.401	lipid binding
GO:0005543	0.367	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0051128	0.960	regulation of cellular component organization
GO:0032502	0.865	developmental process
GO:0120035	0.852	regulation of plasma membrane bounded cell projection organization
GO:0010975	0.844	regulation of neuron projection development
GO:0048856	0.824	anatomical structure development
GO:0032501	0.811	multicellular organismal process
GO:0001764	0.782	neuron migration
GO:0050896	0.311	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0030427	0.988	site of polarized growth
GO:0030424	0.987	axon
GO:0150034	0.983	distal axon
GO:0030426	0.953	growth cone
GO:0043229	0.703	intracellular organelle
GO:0043227	0.668	membrane-bounded organelle
GO:0043231	0.641	intracellular membrane-bounded organelle
GO:0005829	0.425	cytosol
GO:0016020	0.362	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]