StarFunc result for job id Q96P64

User Input

>input (663 residues)
MGNILTCRVHPSVSLEFDQQQGSVCPSESEIYEAGAGDRMAGAPMAAAVQPAEVTVEVGE
DLHMHHVRDREMPEALEFNPSANPEASTIFQRNSQTDVVEIRRSNCTNHVSTVRFSQQYS
LCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDADRSLSIPDEQLHSFAVSTVHIMK
KRNGGGSLNNYSSSIPSTPSTSQEDPQFSVPPTANTPTPVCKRSMRWSNLFTSEKGSDPD
KERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTWKKKYVTLCSNGVLTYYSSLGDYM
KNIHKKEIDLQTSTIKVPGKWPSLATSACTPISTSKSNGLSKDMDTGLGDSICFSPSISS
TTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQTWHFEATTYEERDAWVQAIQSQIL
ASLQSCESSKSKSQLTSQSKAMALQSIQNMRGNAHCVDCETQNPKWASLNLGVLMCIECS
GIHRSLGTRLSRVRSLELDDWPVELRKVMSSIGNDLANSIWEGSSQGQTKPSEKSTREEK
ERWIRSKYEEKLFLAPLPCTELSLGQQLLRATADEDLQTAILLLAHGSREEVNETCGEGD
GCTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALTYARQASSQECINVLLQYGCPD
KCV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F8VVT9	0.462	0.268	1.401E-48	1192	0.440	0.245	F8VVT9.pdb.gz	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
2	AFDB:Q551Q8	0.315	0.249	7.106E-19	843	0.167	0.132	Q551Q8.pdb.gz	Q551Q8_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276395 PE=4 SV=1
3	PDB:3lvqE	0.292	0.451	1.686E-13	420	0.112	0.176	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
4	PDB:3ljuX	0.177	0.309	2.314E-9	373	0.066	0.118	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
5	PDB:3o47A	0.124	0.277	2.329E-5	289	0.050	0.114	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
6	PDB:8cs9A	0.140	0.117	4.017E-4	796	0.044	0.036	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
7	PDB:6v9hC	0.131	0.315	6.401E-4	270	0.039	0.096	6v9hC.pdb.gz
8	PDB:6bbpA	0.118	0.149	1.074E-3	520	0.042	0.054	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
9	PDB:6hhgA	0.126	0.212	1.803E-3	386	0.038	0.065	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
10	PDB:6jd6B	0.131	0.439	1.899E-3	192	0.036	0.125	6jd6B.pdb.gz
11	PDB:4bszB	0.138	0.550	5.079E-3	150	0.044	0.193	4bszB.pdb.gz
12	PDB:7rx9A	0.154	0.223	5.079E-3	432	0.045	0.069	7rx9A.pdb.gz
13	AFDB:P34288	0.135	0.059	7.670E-3	1605	0.097	0.040	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
14	AFDB:X1WE18	0.143	0.093	2.160E-2	1085	0.149	0.091	X1WE18.pdb.gz	KANK2_DANRE KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1
15	AFDB:Q6W2J9	0.130	0.054	2.947E-2	1755	0.115	0.043	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
16	AFDB:F1RCL8	0.131	0.049	3.104E-2	1796	0.155	0.057	F1RCL8.pdb.gz	F1RCL8_DANRE BCL-6 corepressor isoform X1 OS=Danio rerio OX=7955 GN=bcor PE=1 SV=1
17	AFDB:Q8CGN4	0.129	0.053	5.486E-2	1759	0.124	0.047	Q8CGN4.pdb.gz	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2
18	AFDB:Q99KW3	0.130	0.044	6.749E-2	2014	0.098	0.032	Q99KW3.pdb.gz	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
19	AFDB:A2ABF9	0.155	0.089	1.133E-1	1267	0.149	0.078	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
20	AFDB:A0A0B4J203	0.076	0.064	1.256E-1	849	0.113	0.088	A0A0B4J203.pdb.gz	A0A0B4J203_HUMAN Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UPQ3	0.0	557	857	0.422	0.327	AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4
2	U6A022	0.0	573	808	0.431	0.354	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
3	J3KNM6	7.82e-148	457	1036	0.367	0.235	J3KNM6_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
4	F8VVT9	2.62e-143	449	1192	0.370	0.206	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
5	Q99490	3.14e-143	449	1192	0.370	0.206	AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=2
6	Q8CGU4	2.65e-137	433	1186	0.373	0.208	AGAP2_RAT Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Agap2 PE=1 SV=1
7	Q3UHD9	3.34e-137	433	1186	0.373	0.208	AGAP2_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Agap2 PE=1 SV=1
8	Q8VHH5	2.82e-135	421	910	0.296	0.215	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1
9	A0JMI1	1.03e-132	412	827	0.370	0.296	A0JMI1_DANRE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Danio rerio OX=7955 GN=agap2 PE=2 SV=1
10	Q9XX14	5.28e-82	283	1107	0.278	0.166	CNT2_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 OS=Caenorhabditis elegans OX=6239 GN=cnt-2 PE=1 SV=2
11	Q9NGC3	5.75e-75	261	995	0.210	0.140	CEG1A_DROME Centaurin-gamma-1A OS=Drosophila melanogaster OX=7227 GN=CenG1A PE=2 SV=2
12	Q54WI0	1.74e-39	158	1333	0.179	0.089	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
13	Q4QQN0	1.45e-34	141	626	0.122	0.129	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
14	Q8N7R7	1.49e-34	137	359	0.131	0.242	CCYL1_HUMAN Cyclin-Y-like protein 1 OS=Homo sapiens OX=9606 GN=CCNYL1 PE=1 SV=2
15	A2ADA6	2.61e-34	142	829	0.122	0.098	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
16	Q6NXL5	2.61e-34	142	833	0.122	0.097	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
17	Q3UH98	2.64e-34	142	833	0.122	0.097	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
18	Q8MSZ5	2.33e-32	127	235	0.101	0.285	Q8MSZ5_DROME GM06875p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
19	Q15057	4.62e-31	132	778	0.113	0.096	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
20	Q9DE64	8.94e-31	130	757	0.119	0.104	Q9DE64_CHICK p95-APP2 OS=Gallus gallus OX=9031 GN=p95-APP2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3e-06	38.6	Ankyrin repeat
2	PF12796 Ank_2	1.7e-06	39.8	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.1	20.9	Ankyrin repeat
4	PF13637 Ank_4	0.0087	27.9	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.4e-05	36.5	Ankyrin repeats (many copies)
6	PF01412 ArfGap	2.2e-34	129.4	Putative GTPase activating protein for Arf
7	PF00169 PH	3.7e-07	42.0	PH domain
8	PF15413 PH_11	0.18	23.6	Pleckstrin homology domain
9	PF15404 PH_4	68	14.7	Pleckstrin homology domain
10	PF15406 PH_6	8.5	18.1	Pleckstrin homology domain
11	PF15409 PH_8	3.9	19.1	Pleckstrin homology domain
12	PF15410 PH_9	8.1e+02	11.6	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392513

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387176	0.576	POTE ankyrin domain family member J
2	9606.ENSP00000392718	0.567	POTE ankyrin domain family member I
3	9606.ENSP00000237822	0.564	Lipid droplet-associated hydrolase
4	9606.ENSP00000338013	0.515	Coiled-coil domain containing 183

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005543	0.973	phospholipid binding
GO:0003824	0.898	catalytic activity
GO:0098772	0.878	molecular function regulator activity
GO:0016787	0.853	hydrolase activity
GO:0030234	0.417	enzyme regulator activity
GO:0043167	0.397	ion binding
GO:0005096	0.346	GTPase activator activity
GO:0043168	0.345	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.948	anatomical structure development
GO:0009987	0.721	cellular process
GO:0065007	0.672	biological regulation
GO:0032501	0.641	multicellular organismal process
GO:0050789	0.363	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0005634	0.946	nucleus
GO:0071944	0.930	cell periphery
GO:0016020	0.875	membrane
GO:0005886	0.473	plasma membrane
GO:0005829	0.456	cytosol
GO:0012505	0.454	endomembrane system
GO:0070013	0.442	intracellular organelle lumen
GO:0090543	0.370	Flemming body
GO:0005654	0.328	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.853	Hydrolases.

[back to server]