StarFunc result for job id Q96P70

User Input

>input (1041 residues)
MAAAAAAGAASGLPGPVAQGLKEALVDTLTGILSPVQEVRAAAEEQIKVLEVTEEFGVHL
AELTVDPQGALAIRQLASVILKQYVETHWCAQSEKFRPPETTERAKIVIRELLPNGLRES
ISKVRSSVAYAVSAIAHWDWPEAWPQLFNLLMEMLVSGDLNAVHGAMRVLTEFTREVTDT
QMPLVAPVILPEMYKIFTMAEVYGIRTRSRAVEIFTTCAHMICNMEELEKGAAKVLIFPV
VQQFTEAFVQALQIPDGPTSDSGFKMEVLKAVTALVKNFPKHMVSSMQQILPIVWNTLTE
SAAFYVRTEVNYTEEVEDPVDSDGEVLGFENLVFSIFEFVHALLENSKFKSTVKKALPEL
IYYIILYMQITEEQIKVWTANPQQFVEDEDDDTFSYTVRIAAQDLLLAVATDFQNESAAA
LAAAATRHLQEAEQTKNSGTEHWWKIHEACMLALGSVKAIITDSVKNGRIHFDMHGFLTN
VILADLNLSVSPFLLGRALWAASRFTVAMSPELIQQFLQATVSGLHETQPPSVRISAVRA
IWGYCDQLKVSESTHVLQPFLPSILDGLIHLAAQFSSEVLNLVMETLCIVCTVDPEFTAS
MESKICPFTIAIFLKYSNDPVVASLAQDIFKELSQIEACQGPMQMRLIPTLVSIMQAPAD
KIPAGLCATAIDILTTVVRNTKPPLSQLLICQAFPAVAQCTLHTDDNATMQNGGECLRAY
VSVTLEQVAQWHDEQGHNGLWYVMQVVSQLLDPRTSEFTAAFVGRLVSTLISKAGRELGE
NLDQILRAILSKMQQAETLSVMQSLIMVFAHLVHTQLEPLLEFLCSLPGPTGKPALEFVM
AEWTSRQHLFYGQYEGKVSSVALCKLLQHGINADDKRLQDIRVKGEEIYSMDEGIRTRSK
SAKNPERWTNIPLLVKILKLIINELSNVMEANAARQATPAEWSQDDSNDMWEDQEEEEEE
EEDGLAGQLLSDILATSKYEEDYYEDDEEDDPDALKDPLYQIDLQAYLTDFLCQFAQQPC
YIMFSGHLNDNERRVLQTIGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91YE6	0.864	0.864	0.000	1041	0.990	0.990	Q91YE6.pdb.gz	IPO9_MOUSE Importin-9 OS=Mus musculus OX=10090 GN=Ipo9 PE=1 SV=3
2	PDB:6n1zA	0.812	0.875	7.717E-94	961	0.921	0.998	6n1zA.pdb.gz
3	AFDB:Q9VGP4	0.849	0.868	3.330E-54	1018	0.357	0.365	Q9VGP4.pdb.gz	IPO9_DROME Importin-9 OS=Drosophila melanogaster OX=7227 GN=Ipo9 PE=2 SV=1
4	AFDB:Q10297	0.746	0.779	2.366E-32	993	0.218	0.229	Q10297.pdb.gz	IMB5_SCHPO Importin subunit beta-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap114 PE=3 SV=3
5	AFDB:P53067	0.706	0.729	4.083E-26	1004	0.187	0.194	P53067.pdb.gz	IMB5_YEAST Importin subunit beta-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAP114 PE=1 SV=1
6	PDB:6ahoA	0.586	0.655	9.194E-22	916	0.166	0.189	6ahoA.pdb.gz
7	AFDB:F4IRR2	0.567	0.568	4.350E-20	1040	0.161	0.162	F4IRR2.pdb.gz	SAD2_ARATH Importin beta-like SAD2 OS=Arabidopsis thaliana OX=3702 GN=SAD2 PE=1 SV=1
8	AFDB:Q7KIF8	0.541	0.538	1.141E-19	1049	0.150	0.149	Q7KIF8.pdb.gz	Q7KIF8_DROME Ran binding protein 7 OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
9	AFDB:O15397	0.591	0.593	1.610E-19	1037	0.158	0.158	O15397.pdb.gz	IPO8_HUMAN Importin-8 OS=Homo sapiens OX=9606 GN=IPO8 PE=1 SV=2
10	AFDB:O42480	0.556	0.557	5.959E-19	1038	0.150	0.150	O42480.pdb.gz	O42480_XENLA Importin 7 L homeolog OS=Xenopus laevis OX=8355 GN=ipo7.L PE=1 SV=1
11	AFDB:Q8K2V6	0.538	0.569	8.164E-18	975	0.164	0.175	Q8K2V6.pdb.gz	IPO11_MOUSE Importin-11 OS=Mus musculus OX=10090 GN=Ipo11 PE=1 SV=1
12	AFDB:Q9ZPY7	0.539	0.569	1.004E-17	972	0.155	0.166	Q9ZPY7.pdb.gz	XPO2_ARATH Exportin-2 OS=Arabidopsis thaliana OX=3702 GN=CAS PE=2 SV=1
13	PDB:4jlqA	0.493	0.594	3.052E-15	840	0.133	0.164	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
14	PDB:1wa5C	0.593	0.641	2.173E-14	950	0.142	0.156	1wa5C.pdb.gz	Structural basis for the assembly of a nuclear export complex.
15	PDB:1z3hB	0.433	0.475	2.766E-14	914	0.140	0.160	1z3hB.pdb.gz	The structure of the nuclear export receptor cse1 in its cytosolic state reveals a closed conformation incompatible with cargo binding
16	PDB:6fvbA	0.510	0.527	3.789E-13	1001	0.146	0.152	6fvbA.pdb.gz
17	PDB:3nd2A	0.473	0.547	3.096E-12	861	0.135	0.164	3nd2A.pdb.gz
18	PDB:3w3zA	0.399	0.408	3.006E-11	1013	0.153	0.157	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
19	PDB:3w3uA	0.488	0.492	3.220E-11	1030	0.152	0.153	3w3uA.pdb.gz
20	PDB:6xu2A	0.412	0.396	2.820E-10	1091	0.135	0.129	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q91YE6	0.0	2132	1041	0.990	0.990	IPO9_MOUSE Importin-9 OS=Mus musculus OX=10090 GN=Ipo9 PE=1 SV=3
2	Q96P70	0.0	2151	1041	1.000	1.000	IPO9_HUMAN Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3
3	Q9VGP4	0.0	657	1018	0.372	0.380	IPO9_DROME Importin-9 OS=Drosophila melanogaster OX=7227 GN=Ipo9 PE=2 SV=1
4	Q10297	3.22e-49	192	993	0.225	0.236	IMB5_SCHPO Importin subunit beta-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap114 PE=3 SV=3
5	P53067	4.73e-15	82.8	1004	0.056	0.058	IMB5_YEAST Importin subunit beta-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAP114 PE=1 SV=1
6	Q9XZU1	1.10e-10	68.6	975	0.037	0.039	XPO2_DROME Exportin-2 OS=Drosophila melanogaster OX=7227 GN=Cse1 PE=2 SV=2
7	F4IRR2	6.32e-10	65.9	1040	0.041	0.041	SAD2_ARATH Importin beta-like SAD2 OS=Arabidopsis thaliana OX=3702 GN=SAD2 PE=1 SV=1
8	Q9UI26	1.95e-09	64.3	975	0.109	0.116	IPO11_HUMAN Importin-11 OS=Homo sapiens OX=9606 GN=IPO11 PE=1 SV=1
9	Q8K2V6	4.04e-09	63.2	975	0.108	0.115	IPO11_MOUSE Importin-11 OS=Mus musculus OX=10090 GN=Ipo11 PE=1 SV=1
10	Q9ERK4	1.02e-06	55.5	971	0.034	0.036	XPO2_MOUSE Exportin-2 OS=Mus musculus OX=10090 GN=Cse1l PE=1 SV=1
11	A0A384NKW7	1.04e-06	55.5	971	0.034	0.036	A0A384NKW7_HUMAN Exportin-2 OS=Homo sapiens OX=9606 PE=2 SV=1
12	P55060	1.04e-06	55.5	971	0.034	0.036	XPO2_HUMAN Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3
13	Q7SZC2	3.29e-06	53.9	971	0.034	0.036	XPO2_DANRE Exportin-2 OS=Danio rerio OX=7955 GN=cse1l PE=1 SV=2
14	Q8H0U4	1.02e-05	52.0	891	0.040	0.047	TNPO1_ARATH Transportin-1 OS=Arabidopsis thaliana OX=3702 GN=TRN1 PE=1 SV=1
15	Q86NK4	1.91e-05	51.2	1049	0.038	0.038	Q86NK4_DROME GH01576p OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
16	Q9VSD6	1.91e-05	51.2	1049	0.038	0.038	Q9VSD6_DROME D-Importin 7/RanBP7 OS=Drosophila melanogaster OX=7227 GN=msk PE=1 SV=1
17	Q7KIF8	1.93e-05	51.2	1049	0.038	0.038	Q7KIF8_DROME Ran binding protein 7 OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
18	O13671	8.20e-05	49.3	967	0.031	0.033	CSE1_SCHPO Importin-alpha re-exporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap109 PE=3 SV=2
19	P33307	1.14e-04	48.9	960	0.034	0.036	CSE1_YEAST Importin alpha re-exporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSE1 PE=1 SV=2
20	Q9ZPY7	1.31e-04	48.5	972	0.036	0.038	XPO2_ARATH Exportin-2 OS=Arabidopsis thaliana OX=3702 GN=CAS PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03810 IBN_N	3.4e-06	38.2	Importin-beta N-terminal domain
2	PF08167 RIX1	51	15.0	rRNA processing/ribosome biogenesis
3	PF20206 Tra1_ring	47	12.8	Tra1 HEAT repeat ring region
4	PF11701 UNC45-central	7.2e+02	11.5	Myosin-binding striated muscle assembly central
5	PF08389 Xpo1	0.015	26.8	Exportin 1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010377162.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010383134.1	0.842	Importin 7
2	61622.XP_010377662.1	0.839	Karyopherin subunit beta 1
3	61622.XP_010360942.1	0.837	Belongs to the nucleosome assembly protein (NAP) family.
4	61622.XP_010380374.1	0.837	Belongs to the nucleosome assembly protein (NAP) family.
5	61622.XP_010385392.1	0.837	Belongs to the nucleosome assembly protein (NAP) family.
6	61622.XP_010385416.1	0.825	Importin-5
7	61622.XP_010362072.1	0.816	Importin 4
8	61622.XP_010356942.1	0.811	Importin-8
9	61622.XP_010353289.1	0.803	RAN, member RAS oncogene family
10	61622.XP_010377209.1	0.781	Transportin-1 isoform X1
11	61622.XP_010386943.1	0.763	Exportin-6 isoform X1
12	61622.XP_010363399.1	0.729	RAN binding protein 6
13	61622.XP_010359950.1	0.716	Transportin-2 isoform X1
14	61622.XP_010351265.1	0.712	Belongs to the nucleosome assembly protein (NAP) family.
15	61622.XP_010355199.1	0.712	Belongs to the nucleosome assembly protein (NAP) family.
16	61622.XP_010356742.1	0.712	Nucleosome assembly protein 1 like 2
17	61622.XP_010359636.1	0.712	Putative nucleosome assembly protein 1-like 6
18	61622.XP_010362129.1	0.707	Functions in nuclear protein import.
19	61622.XP_010370332.1	0.659	TATA-box binding protein like 2
20	61622.XP_010377003.1	0.659	TATA-box binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	1.000	histone binding
GO:0061608	0.985	nuclear import signal receptor activity
GO:0031267	0.981	small GTPase binding
GO:0140713	0.934	histone chaperone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0046907	0.957	intracellular transport
GO:0071705	0.956	nitrogen compound transport
GO:0071702	0.956	organic substance transport
GO:0008104	0.955	protein localization
GO:0006606	0.950	protein import into nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0016020	0.996	membrane
GO:0005634	0.945	nucleus
GO:0005654	0.910	nucleoplasm
GO:0005829	0.909	cytosol
GO:0012505	0.323	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]