StarFunc result for job id Q96PB1

User Input

>input (797 residues)
MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCEYLLSSGRFLG
EKVWQPHSCMMHKYKISEAKNCLVDKHIAFIGDSRIRQLFYSFVKIINPQFKEEGNKHEN
IPFEDKTASVKVDFLWHPEVNGSMKQCIKVWTEDSIAKPHVIVAGAATWSIKIHNGSSEA
LSQYKMNITSIAPLLEKLAKTSDVYWVLQDPVYEDLLSENRKMITNEKIDAYNEAAVSIL
NSSTRNSKSNVKMFSVSKLIAQETIMESLDGLHLPESSRETTAMILMNVYCNKILKPVDG
SCCQPRPPVTLIQKLAACFFTLSIIGYLIFYIIHRNAHRKNKPCTDLESGEEKKNIINTP
VSSLEILLQSFCKLGLIMAYFYMCDRANLFMKENKFYTHSSFFIPIIYILVLGVFYNENT
KETKVLNREQTDEWKGWMQLVILIYHISGASTFLPVYMHIRVLVAAYLFQTGYGHFSYFW
IKGDFGIYRVCQVLFRLNFLVVVLCIVMDRPYQFYYFVPLVTVWFMVIYVTLALWPQIIQ
KKANGNCFWHFGLLLKLGFLLLFICFLAYSQGAFEKIFSLWPLSKCFELKGNVYEWWFRW
RLDRYVVFHGMLFAFIYLALQKRQILSEGKGEPLFSNKISNFLLFISVVSFLTYSIWASS
CKNKAECNELHPSVSVVQILAFILIRNIPGYARSVYSSFFAWFGKISLELFICQYHIWLA
ADTRGILVLIPGNPMLNIIVSTFIFVCVAHEISQITNDLAQIIIPKDNSSLLKRLACIAA
FFCGLLILSSIQDKSKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TN73	0.995	0.995	0.000	797	0.949	0.949	Q7TN73.pdb.gz	CASD1_MOUSE N-acetylneuraminate 9-O-acetyltransferase OS=Mus musculus OX=10090 GN=Casd1 PE=2 SV=1
2	AFDB:Q66GQ5	0.521	0.754	3.700E-23	540	0.186	0.274	Q66GQ5.pdb.gz	RWA3_ARATH Protein REDUCED WALL ACETYLATION 3 OS=Arabidopsis thaliana OX=3702 GN=RWA3 PE=1 SV=1
3	AFDB:Q9FXG3	0.520	0.751	3.700E-23	540	0.191	0.281	Q9FXG3.pdb.gz	RWA4_ARATH Protein REDUCED WALL ACETYLATION 4 OS=Arabidopsis thaliana OX=3702 GN=RWA4 PE=2 SV=2
4	AFDB:Q8L7C8	0.512	0.740	7.996E-23	540	0.192	0.283	Q8L7C8.pdb.gz	RWA1_ARATH Protein REDUCED WALL ACETYLATION 1 OS=Arabidopsis thaliana OX=3702 GN=RWA1 PE=2 SV=1
5	AFDB:Q0WW17	0.511	0.730	1.655E-22	545	0.181	0.264	Q0WW17.pdb.gz	RWA2_ARATH Protein REDUCED WALL ACETYLATION 2 OS=Arabidopsis thaliana OX=3702 GN=RWA2 PE=1 SV=1
6	AFDB:Q9M9N9	0.266	0.552	1.388E-8	368	0.060	0.130	Q9M9N9.pdb.gz	AXY9_ARATH Protein ALTERED XYLOGLUCAN 9 OS=Arabidopsis thaliana OX=3702 GN=AXY9 PE=1 SV=1
7	AFDB:Q9H1Q7	0.235	0.401	4.682E-6	454	0.041	0.073	Q9H1Q7.pdb.gz	PED1A_HUMAN PC-esterase domain-containing protein 1A OS=Homo sapiens OX=9606 GN=PCED1A PE=1 SV=1
8	AFDB:Q96HM7	0.236	0.419	5.557E-6	432	0.045	0.083	Q96HM7.pdb.gz	PED1B_HUMAN PC-esterase domain-containing protein 1B OS=Homo sapiens OX=9606 GN=PCED1B PE=1 SV=1
9	AFDB:Q9LDG2	0.230	0.377	1.012E-5	469	0.055	0.094	Q9LDG2.pdb.gz	TBL10_ARATH Protein trichome birefringence-like 10 OS=Arabidopsis thaliana OX=3702 GN=TBL10 PE=2 SV=1
10	AFDB:Q84TV3	0.217	0.347	1.253E-5	473	0.056	0.095	Q84TV3.pdb.gz	XOATE_ORYSJ Xylan O-acetyltransferase 14 OS=Oryza sativa subsp. japonica OX=39947 GN=XOAT14 PE=1 SV=1
11	PDB:6cciA	0.211	0.438	6.684E-5	354	0.059	0.133	6cciA.pdb.gz
12	PDB:7e16A	0.187	0.620	2.333E-3	207	0.038	0.145	7e16A.pdb.gz
13	PDB:3dt9A	0.162	0.501	2.793E-2	212	0.040	0.151	3dt9A.pdb.gz	Crystal structures of brain group-VIII phospholipase A2 in nonaged complexes with the organophosphorus nerve agents soman and sarin.
14	PDB:3w7vA	0.171	0.506	3.043E-2	219	0.040	0.146	3w7vA.pdb.gz
15	PDB:3milA	0.180	0.508	4.286E-2	240	0.036	0.121	3milA.pdb.gz
16	PDB:1vyhA	0.165	0.496	4.473E-2	218	0.044	0.161	1vyhA.pdb.gz
17	PDB:3zjcF	0.133	0.303	7.477E-2	252	0.030	0.095	3zjcF.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
18	PDB:2gf0B	0.117	0.360	9.666E-2	174	0.025	0.115	2gf0B.pdb.gz	The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state
19	PDB:7r5jB0	0.121	0.070	1.147E-1	1748	0.105	0.048	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:3ieuA	0.113	0.240	1.361E-1	293	0.035	0.096	3ieuA.pdb.gz	Structure of ERA in complex with the 3' end of 16S rRNA: implications for ribosome biogenesis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TN73	0.0	1523	797	0.949	0.949	CASD1_MOUSE N-acetylneuraminate 9-O-acetyltransferase OS=Mus musculus OX=10090 GN=Casd1 PE=2 SV=1
2	Q96PB1	0.0	1644	797	1.000	1.000	CASD1_HUMAN N-acetylneuraminate 9-O-acetyltransferase OS=Homo sapiens OX=9606 GN=CASD1 PE=1 SV=1
3	Q8L7C8	3.53e-61	218	540	0.179	0.265	RWA1_ARATH Protein REDUCED WALL ACETYLATION 1 OS=Arabidopsis thaliana OX=3702 GN=RWA1 PE=2 SV=1
4	Q9FXG3	2.32e-59	213	540	0.177	0.261	RWA4_ARATH Protein REDUCED WALL ACETYLATION 4 OS=Arabidopsis thaliana OX=3702 GN=RWA4 PE=2 SV=2
5	Q66GQ5	1.08e-58	211	540	0.177	0.261	RWA3_ARATH Protein REDUCED WALL ACETYLATION 3 OS=Arabidopsis thaliana OX=3702 GN=RWA3 PE=1 SV=1
6	Q0WW17	2.89e-56	204	545	0.173	0.253	RWA2_ARATH Protein REDUCED WALL ACETYLATION 2 OS=Arabidopsis thaliana OX=3702 GN=RWA2 PE=1 SV=1
7	Q8RXQ1	0.021	40.4	449	0.039	0.069	TBL35_ARATH Protein trichome birefringence-like 35 OS=Arabidopsis thaliana OX=3702 GN=TBL35 PE=2 SV=1
8	A4D0V7	0.023	40.8	1026	0.023	0.018	CPED1_HUMAN Cadherin-like and PC-esterase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CPED1 PE=2 SV=1
9	P0ABV2	0.026	38.5	141	0.024	0.135	EXBD_ECOLI Biopolymer transport protein ExbD OS=Escherichia coli (strain K12) OX=83333 GN=exbD PE=1 SV=1
10	Q8LED3	0.075	38.9	434	0.030	0.055	TBL3_ARATH Protein trichome birefringence-like 3 OS=Arabidopsis thaliana OX=3702 GN=TBL3 PE=2 SV=1
11	Q1PFD9	0.095	38.5	413	0.034	0.065	TBL31_ARATH Protein trichome birefringence-like 31 OS=Arabidopsis thaliana OX=3702 GN=TBL31 PE=2 SV=1
12	O04523	0.12	38.1	416	0.030	0.058	TBL27_ARATH Xyloglucan O-acetyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=AXY4 PE=1 SV=1
13	F4K5L5	0.17	37.7	551	0.021	0.031	TBL16_ARATH Protein trichome birefringence-like 16 OS=Arabidopsis thaliana OX=3702 GN=TBL16 PE=2 SV=1
14	Q84TV3	0.18	37.7	473	0.035	0.059	XOATE_ORYSJ Xylan O-acetyltransferase 14 OS=Oryza sativa subsp. japonica OX=39947 GN=XOAT14 PE=1 SV=1
15	O80919	0.19	37.4	410	0.029	0.056	TBL34_ARATH Protein trichome birefringence-like 34 OS=Arabidopsis thaliana OX=3702 GN=TBL34 PE=2 SV=2
16	Q2QYU2	0.22	37.4	502	0.029	0.046	XOATD_ORYSJ Xylan O-acetyltransferase 13 OS=Oryza sativa subsp. japonica OX=39947 GN=XOAT13 PE=1 SV=1
17	Q2RBL8	0.23	37.4	503	0.029	0.046	XOATC_ORYSJ Xylan O-acetyltransferase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=XOAT12 PE=1 SV=1
18	Q9LY46	0.67	35.8	487	0.036	0.060	TBL29_ARATH Xylan O-acetyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=ESK1 PE=1 SV=1
19	Q9SRL3	0.86	35.4	451	0.024	0.042	TBL32_ARATH Protein trichome birefringence-like 32 OS=Arabidopsis thaliana OX=3702 GN=TBL32 PE=2 SV=1
20	Q84TW8	1.3	34.7	441	0.025	0.045	XOATA_ORYSJ Probable xylan O-acetyltransferase 10 OS=Oryza sativa subsp. japonica OX=39947 GN=XOAT10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07779 Cas1_AcylT	6.1e-220	742.7	10 TM Acyl Transferase domain found in Cas1p
2	PF13839 PC-Esterase	2.2e+02	13.0	GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297273

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263593	0.753	Sialate O-acetylesterase
2	9606.ENSP00000321343	0.748	Alpha-2,8-sialyltransferase 8E
3	9606.ENSP00000418944	0.737	Retrotransposon-derived protein PEG10
4	9606.ENSP00000379353	0.720	Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
5	9606.ENSP00000268164	0.696	Alpha-2,8-sialyltransferase 8B
6	9606.ENSP00000398930	0.614	Epsilon-sarcoglycan
7	9606.ENSP00000309772	0.605	Cadherin like and PC-esterase domain containing 1
8	9606.ENSP00000320431	0.584	Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase
9	9606.ENSP00000417583	0.583	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
10	9606.ENSP00000402346	0.568	Coatomer subunit gamma-2
11	9606.ENSP00000386942	0.543	Beta-galactoside alpha-2,6-sialyltransferase 2
12	9606.ENSP00000436047	0.529	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
13	9606.ENSP00000294064	0.525	Sialidase-3
14	9606.ENSP00000405514	0.500	Neurabin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016413	0.999	O-acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.983	primary metabolic process
GO:0005975	0.930	carbohydrate metabolic process
GO:0009987	0.805	cellular process
GO:0044237	0.621	cellular metabolic process
GO:1901576	0.432	organic substance biosynthetic process
GO:0044249	0.428	cellular biosynthetic process
GO:0043170	0.310	macromolecule metabolic process
GO:0044260	0.304	cellular macromolecule metabolic process
GO:0006807	0.300	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.998	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	0.999	Transferring groups other than amino-acyl groups.

[back to server]