StarFunc result for job id Q96PC2

User Input

>input (410 residues)
MVVQNSADAGDMRAGVQLEPFLHQVGGHMSVMKYDEHTVCKPLVSREQRFYESLPLAMKR
FTPQYKGTVTVHLWKDSTGHLSLVANPVKESQEPFKVSTESAAVAIWQTLQQTTGSNGSD
CTLAQWPHAQLARSPKESPAKALLRSEPHLNTPAFSLVEDTNGNQVERKSFNPWGLQCHQ
AHLTRLCSEYPENKRHRFLLLENVVSQYTHPCVLDLKMGTRQHGDDASEEKKARHMRKCA
QSTSACLGVRICGMQVYQTDKKYFLCKDKYYGRKLSVEGFRQALYQFLHNGSHLRRELLE
PILHQLRALLSVIRSQSSYRFYSSSLLVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGL
TKVDIRMIDFAHTTYKGYWNEHTTYDGPDPGYIFGLENLIRILQDIQEGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96PC2	1.000	1.000	2.290E-81	410	1.000	1.000	Q96PC2.pdb.gz	IP6K3_HUMAN Inositol hexakisphosphate kinase 3 OS=Homo sapiens OX=9606 GN=IP6K3 PE=1 SV=2
2	AFDB:Q8BWD2	0.806	0.834	4.057E-62	396	0.749	0.775	Q8BWD2.pdb.gz	IP6K3_MOUSE Inositol hexakisphosphate kinase 3 OS=Mus musculus OX=10090 GN=Ip6k3 PE=2 SV=1
3	AFDB:A0A024R2X2	0.741	0.691	4.835E-49	441	0.522	0.485	A0A024R2X2.pdb.gz
4	AFDB:B2RCP4	0.770	0.742	8.038E-44	426	0.451	0.434	B2RCP4.pdb.gz	B2RCP4_HUMAN Kinase OS=Homo sapiens OX=9606 GN=IHPK2 PE=2 SV=1
5	AFDB:Q80V72	0.775	0.712	3.274E-43	448	0.454	0.415	Q80V72.pdb.gz	IP6K2_MOUSE Inositol hexakisphosphate kinase 2 OS=Mus musculus OX=10090 GN=Ip6k2 PE=2 SV=2
6	AFDB:Q6PBN6	0.755	0.672	6.798E-42	463	0.446	0.395	Q6PBN6.pdb.gz	Q6PBN6_DANRE Kinase OS=Danio rerio OX=7955 GN=ihpk2 PE=2 SV=1
7	AFDB:O74561	0.614	0.271	3.304E-26	967	0.329	0.140	O74561.pdb.gz	YCZ8_SCHPO Uncharacterized inositol polyphosphate kinase C970.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.08 PE=1 SV=1
8	AFDB:Q12494	0.575	0.234	1.077E-21	1050	0.285	0.111	Q12494.pdb.gz	KCS1_YEAST Inositol hexakisphosphate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KCS1 PE=1 SV=1
9	AFDB:Q54XR3	0.545	0.319	1.890E-20	716	0.237	0.135	Q54XR3.pdb.gz	Q54XR3_DICDI Kinase OS=Dictyostelium discoideum OX=44689 GN=I6KA PE=3 SV=1
10	AFDB:Q8NFU5	0.538	0.531	2.238E-19	416	0.202	0.200	Q8NFU5.pdb.gz	IPMK_HUMAN Inositol polyphosphate multikinase OS=Homo sapiens OX=9606 GN=IPMK PE=1 SV=1
11	PDB:2iewA	0.409	0.636	6.566E-16	258	0.149	0.236	2iewA.pdb.gz	Crystal structure of inositol phosphate multikinase 2 and implications for substrate specificity.
12	PDB:4frfA	0.404	0.754	2.529E-14	214	0.134	0.257	4frfA.pdb.gz
13	PDB:4axdA	0.154	0.148	1.097E-1	433	0.088	0.083	4axdA.pdb.gz	Conformational Changes Undergone by Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase Upon Substrate Binding: The Role of N-Lobe and Enantiomeric Substrate Preference
14	PDB:5xqiB	0.120	0.167	1.227E-1	276	0.061	0.091	5xqiB.pdb.gz
15	PDB:1bo1A	0.184	0.220	2.408E-1	326	0.078	0.098	1bo1A.pdb.gz
16	PDB:4lv7A	0.134	0.138	2.694E-1	390	0.080	0.085	4lv7A.pdb.gz	Conformational stability of inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1) dictates its substrate selectivity.
17	PDB:3j79Y	0.062	0.170	5.915E-1	101	0.024	0.099	3j79Y.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
18	PDB:6nm5M	0.071	0.073	6.619E-1	393	0.039	0.041	6nm5M.pdb.gz	Structural basis for the adsorption of a single-stranded RNA bacteriophage.
19	PDB:6fl3B	0.156	0.153	1.161	420	0.088	0.086	6fl3B.pdb.gz	A Fluorescent Probe Identifies Active Site Ligands of Inositol Pentakisphosphate 2-Kinase.
20	PDB:2grvA	0.055	0.047	1.228	516	0.027	0.021	2grvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BWD2	0.0	628	396	0.751	0.778	IP6K3_MOUSE Inositol hexakisphosphate kinase 3 OS=Mus musculus OX=10090 GN=Ip6k3 PE=2 SV=1
2	Q96PC2	0.0	862	410	1.000	1.000	IP6K3_HUMAN Inositol hexakisphosphate kinase 3 OS=Homo sapiens OX=9606 GN=IP6K3 PE=1 SV=2
3	Q9ESM0	1.11e-142	415	433	0.527	0.499	IP6K1_RAT Inositol hexakisphosphate kinase 1 OS=Rattus norvegicus OX=10116 GN=Ip6k1 PE=2 SV=1
4	Q6PD10	3.03e-142	414	433	0.524	0.497	IP6K1_MOUSE Inositol hexakisphosphate kinase 1 OS=Mus musculus OX=10090 GN=Ip6k1 PE=2 SV=1
5	Q92551	1.11e-140	410	441	0.537	0.499	IP6K1_HUMAN Inositol hexakisphosphate kinase 1 OS=Homo sapiens OX=9606 GN=IP6K1 PE=1 SV=3
6	B2RCP4	1.09e-120	358	426	0.454	0.437	B2RCP4_HUMAN Kinase OS=Homo sapiens OX=9606 GN=IHPK2 PE=2 SV=1
7	Q9UHH9	1.09e-120	358	426	0.454	0.437	IP6K2_HUMAN Inositol hexakisphosphate kinase 2 OS=Homo sapiens OX=9606 GN=IP6K2 PE=1 SV=2
8	Q9R0U1	4.71e-119	354	425	0.454	0.438	IP6K2_RAT Inositol hexakisphosphate kinase 2 OS=Rattus norvegicus OX=10116 GN=Ip6k2 PE=2 SV=2
9	Q80V72	2.36e-114	343	448	0.456	0.417	IP6K2_MOUSE Inositol hexakisphosphate kinase 2 OS=Mus musculus OX=10090 GN=Ip6k2 PE=2 SV=2
10	Q6PBN6	1.82e-104	318	463	0.437	0.387	Q6PBN6_DANRE Kinase OS=Danio rerio OX=7955 GN=ihpk2 PE=2 SV=1
11	C9JNA8	1.12e-74	236	274	0.315	0.471	C9JNA8_HUMAN Kinase OS=Homo sapiens OX=9606 GN=IP6K1 PE=1 SV=1
12	O74561	4.95e-31	127	967	0.195	0.083	YCZ8_SCHPO Uncharacterized inositol polyphosphate kinase C970.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.08 PE=1 SV=1
13	Q12494	6.90e-27	115	1050	0.141	0.055	KCS1_YEAST Inositol hexakisphosphate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KCS1 PE=1 SV=1
14	Q57X56	5.70e-25	109	756	0.166	0.090	Q57X56_TRYB2 Kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.1100 PE=3 SV=1
15	Q9VPR6	3.46e-24	103	309	0.198	0.262	Q9VPR6_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=Ipk2 PE=3 SV=2
16	Q8MRX9	3.50e-24	103	309	0.198	0.262	Q8MRX9_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=Ipk2 PE=2 SV=1
17	Q99NI4	1.78e-17	85.9	396	0.115	0.119	IPMK_RAT Inositol polyphosphate multikinase OS=Rattus norvegicus OX=10116 GN=Ipmk PE=1 SV=1
18	Q7TT16	2.18e-17	85.5	396	0.100	0.104	IPMK_MOUSE Inositol polyphosphate multikinase OS=Mus musculus OX=10090 GN=Ipmk PE=1 SV=1
19	Q8NFU5	2.20e-17	85.5	416	0.100	0.099	IPMK_HUMAN Inositol polyphosphate multikinase OS=Homo sapiens OX=9606 GN=IPMK PE=1 SV=1
20	Q55AP4	1.86e-15	79.0	307	0.151	0.202	Q55AP4_DICDI Kinase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271760 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03770 IPK	3.9e-60	214.6	Inositol polyphosphate kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398861

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482907	0.989	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2
2	9606.ENSP00000400887	0.985	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1
3	9606.ENSP00000287996	0.963	Inositol-pentakisphosphate 2-kinase
4	9606.ENSP00000331103	0.907	Inositol hexakisphosphate kinase 2
5	9606.ENSP00000482032	0.907	Inositol hexakisphosphate kinase 1
6	9606.ENSP00000361064	0.783	Multiple inositol polyphosphate phosphatase 1
7	9606.ENSP00000260386	0.728	Inositol-trisphosphate 3-kinase A
8	9606.ENSP00000411152	0.726	Inositol-trisphosphate 3-kinase B
9	9606.ENSP00000264864	0.696	Phosphatidylinositol 4-kinase type 2-beta
10	9606.ENSP00000439170	0.585	Tubulin-specific chaperone E
11	9606.ENSP00000417196	0.573	Poly(rC)-binding protein 4
12	9606.ENSP00000420008	0.564	Poly(rC)-binding protein 4
13	9606.ENSP00000300900	0.548	Carbonic anhydrase 4
14	9606.ENSP00000378367	0.523	Pro-neuregulin-4, membrane-bound isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016776	1.000	phosphotransferase activity, phosphate group as acceptor
GO:0016773	1.000	phosphotransferase activity, alcohol group as acceptor
GO:0016301	1.000	kinase activity
GO:0000827	0.994	inositol-1,3,4,5,6-pentakisphosphate kinase activity
GO:0000828	0.993	inositol hexakisphosphate kinase activity
GO:0000829	0.968	inositol heptakisphosphate kinase activity
GO:0052839	0.945	inositol diphosphate tetrakisphosphate kinase activity
GO:0052836	0.945	inositol 5-diphosphate pentakisphosphate 5-kinase activity
GO:0000831	0.655	inositol hexakisphosphate 6-kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0071704	0.992	organic substance metabolic process
GO:0019637	0.984	organophosphate metabolic process
GO:0046486	0.981	glycerolipid metabolic process
GO:0006796	0.976	phosphate-containing compound metabolic process
GO:0019751	0.969	polyol metabolic process
GO:0043647	0.954	inositol phosphate metabolic process
GO:0006650	0.914	glycerophospholipid metabolic process
GO:0009058	0.879	biosynthetic process
GO:1901576	0.850	organic substance biosynthetic process
GO:0046488	0.827	phosphatidylinositol metabolic process
GO:0090407	0.759	organophosphate biosynthetic process
GO:0006807	0.568	nitrogen compound metabolic process
GO:0050789	0.425	regulation of biological process
GO:0050794	0.378	regulation of cellular process
GO:1901564	0.309	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043226	0.947	organelle
GO:0043227	0.918	membrane-bounded organelle
GO:0043229	0.906	intracellular organelle
GO:0005634	0.884	nucleus
GO:0031981	0.557	nuclear lumen
GO:0005654	0.539	nucleoplasm
GO:0043232	0.316	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.4.-	1.000	Phosphotransferases with a phosphate group as acceptor.
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.4.21	0.994	inositol-hexakisphosphate 5-kinase.

[back to server]