StarFunc result for job id Q96PC5

User Input

>input (1412 residues)
MAKFGVHRILLLAISLTKCLESTKLLADLKKCGDLECEALINRVSAMRDYRGPDCRYLNF
TKGEEISVYVKLAGEREDLWAGSKGKEFGYFPRDAVQIEEVFISEEIQMSTKESDFLCLL
GVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPA
LEAPEDIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFE
SVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTEHQQESESEIDSVPKTQSELASESEH
IPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILT
EKKDTITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELD
PEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIPYLKKFLYNFDNPWNFQNIPKETELP
FPKQILDQNNVIENEETGEFSIDNYPTDNTKVMIFKSSYSLSDMVSNIELPTRIHEEVYF
EPSSSKDSDENSKPSVDTEGPALVEIDRSVENTLLNSQMVSTDNSLSSQNYISQKEDASE
FQILKYLFQIDVYDFMNSAFSPIVILTERVVAALPEGMRPDSNLYGFPWELVICAAVVGF
FAVLFFLWRSFRSVRSRLYVGREKKLALMLSGLIEEKSKLLEKFSLVQKEYEGYEVESSL
KDASFEKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMADISKR
IQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQLQESQKQLLQEAEVW
KEQVSELNKQKVTFEDSKVHAEQVLNDKESHIKTLTERLLKMKDWAAMLGEDITDDDNLE
LEMNSESENGAYLDNPPKGALKKLIHAAKLNASLKTLEGERNQIYIQLSEVDKTKEELTE
HIKNLQTEQASLQSENTHFENENQKLQQKLKVMTELYQENEMKLHRKLTVEENYRLEKEE
KLSKVDEKISHATEELETYRKRAKDLEEELERTIHSYQGQIISHEKKAHDNWLAARNAER
NLNDLRKENAHNRQKLTETELKFELLEKDPYALDVPNTAFGREHSPYGPSPLGWPSSETR
AFLSPPTLLEGPLRLSPLLPGGGGRGSRGPGNPLDHQITNERGESSCDRLTDPHRAPSDT
GSLSPPWDQDRRMMFPPPGQSYPDSALPPQRQDRFCSNSGRLSGPAELRSFNMPSLDKMD
GSMPSEMESSRNDTKDDLGNLNVPDSSLPAENEATGPGFVPPPLAPIRGPLFPVDARGPF
LRRGPPFPPPPPGAMFGASRDYFPPGDFPGPPPAPFAMRNVYPPRGFPPYLPPRPGFFPP
PPHSEGRSEFPSGLIPPSNEPATEHPEPQQET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91ZV0	0.178	0.180	0.000	1396	0.680	0.688	Q91ZV0.pdb.gz	MIA2_MOUSE Melanoma inhibitory activity protein 2 OS=Mus musculus OX=10090 GN=Mia2 PE=1 SV=3
2	AFDB:Q96PC5	0.999	0.999	0.000	1412	1.000	1.000	Q96PC5.pdb.gz	MIA2_HUMAN Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=4
3	AFDB:Q8BI84	0.164	0.129	3.472E-34	1930	0.260	0.190	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
4	AFDB:Q5JRA6	0.163	0.129	1.096E-33	1907	0.254	0.188	Q5JRA6.pdb.gz	TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1
5	PDB:1k0xA	0.067	0.804	5.146E-9	108	0.024	0.315	1k0xA.pdb.gz
6	AFDB:Q9VA36	0.046	0.072	3.140E-8	882	0.055	0.087	Q9VA36.pdb.gz	Q9VA36_DROME CIN85 and CD2AP related, isoform C OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=2
7	AFDB:Q54DW4	0.043	0.045	7.646E-7	1350	0.062	0.065	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
8	AFDB:Q9VZI2	0.040	0.050	2.264E-6	1073	0.058	0.076	Q9VZI2.pdb.gz	ACK_DROME Activated Cdc42 kinase Ack OS=Drosophila melanogaster OX=7227 GN=Ack PE=1 SV=2
9	AFDB:Q0VF96	0.059	0.063	2.923E-6	1302	0.135	0.146	Q0VF96.pdb.gz	CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2
10	AFDB:A4FU49	0.044	0.094	9.832E-6	640	0.059	0.130	A4FU49.pdb.gz	SH321_HUMAN SH3 domain-containing protein 21 OS=Homo sapiens OX=9606 GN=SH3D21 PE=2 SV=2
11	AFDB:Q6AW69	0.074	0.080	1.985E-5	1298	0.123	0.133	Q6AW69.pdb.gz	CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus OX=10090 GN=Cgnl1 PE=1 SV=3
12	PDB:3qwyA	0.041	0.323	7.433E-5	170	0.010	0.082	3qwyA.pdb.gz
13	PDB:2dybA	0.039	0.174	1.239E-4	298	0.014	0.067	2dybA.pdb.gz
14	PDB:1griA	0.042	0.256	2.346E-4	211	0.011	0.071	1griA.pdb.gz
15	PDB:4mt6A	0.035	0.123	2.841E-4	389	0.012	0.044	4mt6A.pdb.gz
16	PDB:1k9aB	0.042	0.130	6.113E-4	441	0.008	0.025	1k9aB.pdb.gz
17	PDB:3ehqA	0.040	0.286	9.558E-4	182	0.006	0.044	3ehqA.pdb.gz
18	PDB:6x5hA	0.039	0.114	2.655E-3	467	0.008	0.024	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
19	PDB:2lqnA	0.042	0.170	3.428E-3	303	0.016	0.073	2lqnA.pdb.gz
20	PDB:2eyzA	0.046	0.193	4.425E-3	304	0.012	0.056	2eyzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V599	0.0	1073	1339	0.370	0.391	G3V599_HUMAN MIA SH3 domain ER export factor 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=1
2	Q91ZV0	0.0	1704	1396	0.682	0.690	MIA2_MOUSE Melanoma inhibitory activity protein 2 OS=Mus musculus OX=10090 GN=Mia2 PE=1 SV=3
3	Q96PC5	0.0	2887	1412	1.000	1.000	MIA2_HUMAN Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=4
4	Q8BI84	5.89e-61	233	1930	0.113	0.083	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
5	Q5JRA6	2.15e-58	225	1907	0.119	0.088	TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1
6	Q9NRC9	1.94e-15	76.6	128	0.029	0.320	OTOR_HUMAN Otoraplin OS=Homo sapiens OX=9606 GN=OTOR PE=1 SV=1
7	Q16674	3.31e-13	70.1	131	0.024	0.260	MIA_HUMAN Melanoma-derived growth regulatory protein OS=Homo sapiens OX=9606 GN=MIA PE=1 SV=1
8	Q61865	3.35e-13	70.1	130	0.025	0.277	MIA_MOUSE Melanoma-derived growth regulatory protein OS=Mus musculus OX=10090 GN=Mia PE=2 SV=2
9	A0A0A0MRH6	3.33e-12	73.9	1015	0.055	0.076	A0A0A0MRH6_HUMAN MIA SH3 domain ER export factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=6
10	Q9JIE3	8.17e-12	66.2	128	0.025	0.281	OTOR_MOUSE Otoraplin OS=Mus musculus OX=10090 GN=Otor PE=2 SV=1
11	Q9VMA7	1.92e-11	71.6	1430	0.081	0.080	TGO1_DROME Transport and Golgi organization protein 1 OS=Drosophila melanogaster OX=7227 GN=Tango1 PE=1 SV=2
12	Q90Y37	0.029	41.6	1375	0.084	0.086	Q90Y37_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock2 PE=1 SV=1
13	P42566	0.044	40.8	896	0.031	0.049	EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2
14	Q3UU96	0.14	39.3	1719	0.067	0.055	MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus OX=10090 GN=Cdc42bpa PE=1 SV=2
15	Q5AS68	0.20	38.9	1569	0.037	0.033	Q5AS68_EMENI Aspergillus nidulans myosin V homolog (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08862 PE=3 SV=1
16	O14578	0.27	38.5	2027	0.071	0.049	CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT PE=1 SV=2
17	O54874	0.27	38.5	1732	0.065	0.053	MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus OX=10116 GN=Cdc42bpa PE=1 SV=1
18	E9PV66	0.52	37.4	2605	0.026	0.014	E9PV66_MOUSE Myosin XVIIIb OS=Mus musculus OX=10090 GN=Myo18b PE=1 SV=1
19	A2AQP0	0.56	37.4	1941	0.026	0.019	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
20	P85120	0.59	37.4	2058	0.068	0.047	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07653 SH3_2	1.1e-07	42.8	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008955389.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003827130.1	0.845	Prolactin regulatory element binding
2	9597.XP_003814931.1	0.743	MIA family member 3, ER export factor
3	9597.XP_008953618.1	0.665	SEC24 homolog B, COPII coat complex component
4	9597.XP_008968322.1	0.603	Plays a role in the organization of the endoplasmic reticulum exit sites (ERES), also known as transitional endoplasmic reticulum (tER). Required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus
5	9597.XP_008974040.1	0.572	Spermatogenic leucine zipper 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038024	1.000	cargo receptor activity
GO:0005515	1.000	protein binding
GO:0008047	1.000	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0070972	0.992	protein localization to endoplasmic reticulum
GO:0048193	0.990	Golgi vesicle transport
GO:0032527	0.987	protein exit from endoplasmic reticulum
GO:0006888	0.984	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0065007	0.611	biological regulation
GO:0035459	0.434	vesicle cargo loading
GO:0050794	0.427	regulation of cellular process
GO:0070973	0.427	protein localization to endoplasmic reticulum exit site
GO:0042953	0.302	lipoprotein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.995	endoplasmic reticulum
GO:0016020	0.991	membrane
GO:0031090	0.967	organelle membrane
GO:0005789	0.952	endoplasmic reticulum membrane
GO:0070971	0.728	endoplasmic reticulum exit site

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]