StarFunc result for job id Q96PD4

User Input

>input (163 residues)
MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIG
IINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNS
VPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96PD4	1.000	1.000	3.592E-28	163	1.000	1.000	Q96PD4.pdb.gz	IL17F_HUMAN Interleukin-17F OS=Homo sapiens OX=9606 GN=IL17F PE=1 SV=3
2	PDB:6hgoC	0.753	0.963	6.701E-21	127	0.779	1.000	6hgoC.pdb.gz
3	AFDB:Q7TNI7	0.613	0.620	5.078E-16	161	0.546	0.553	Q7TNI7.pdb.gz	IL17F_MOUSE Interleukin-17F OS=Mus musculus OX=10090 GN=Il17f PE=1 SV=1
4	AFDB:Q16552	0.560	0.587	1.221E-13	155	0.423	0.445	Q16552.pdb.gz	IL17_HUMAN Interleukin-17A OS=Homo sapiens OX=9606 GN=IL17A PE=1 SV=1
5	AFDB:Q62386	0.591	0.607	7.450E-13	158	0.380	0.392	Q62386.pdb.gz	IL17_MOUSE Interleukin-17A OS=Mus musculus OX=10090 GN=Il17a PE=1 SV=1
6	AFDB:Q61453	0.576	0.622	1.644E-12	150	0.344	0.373	Q61453.pdb.gz	IL17_RAT Interleukin-17A OS=Rattus norvegicus OX=10116 GN=Il17a PE=2 SV=1
7	PDB:4qhuC	0.590	0.791	2.000E-11	119	0.356	0.487	4qhuC.pdb.gz
8	PDB:7uwmA	0.520	0.765	3.326E-11	109	0.356	0.532	7uwmA.pdb.gz
9	AFDB:Q5TKT0	0.513	0.516	2.376E-10	162	0.270	0.272	Q5TKT0.pdb.gz	Q5TKT0_DANRE Interleukin 17_5 OS=Danio rerio OX=7955 GN=f3 PE=2 SV=1
10	AFDB:Q8K4C5	0.444	0.377	2.857E-9	194	0.264	0.222	Q8K4C5.pdb.gz	IL17C_MOUSE Interleukin-17C OS=Mus musculus OX=10090 GN=Il17c PE=1 SV=1
11	AFDB:Q9P0M4	0.455	0.382	9.362E-9	197	0.258	0.213	Q9P0M4.pdb.gz	IL17C_HUMAN Interleukin-17C OS=Homo sapiens OX=9606 GN=IL17C PE=1 SV=1
12	AFDB:Q5TKT1	0.456	0.358	3.068E-8	212	0.270	0.208	Q5TKT1.pdb.gz	Q5TKT1_DANRE Interleukin 17_4 OS=Danio rerio OX=7955 GN=zgc:194303 PE=2 SV=1
13	AFDB:Q8TAD2	0.473	0.389	3.846E-8	202	0.209	0.168	Q8TAD2.pdb.gz	IL17D_HUMAN Interleukin-17D OS=Homo sapiens OX=9606 GN=IL17D PE=2 SV=1
14	PDB:7uwnE	0.469	0.788	1.205E-7	93	0.288	0.505	7uwnE.pdb.gz
15	PDB:1wq8A	0.264	0.355	1.453E-2	100	0.104	0.170	1wq8A.pdb.gz
16	PDB:7ag0A	0.328	0.372	1.821E-2	140	0.092	0.107	7ag0A.pdb.gz
17	PDB:1m4uA	0.315	0.266	5.967E-2	199	0.074	0.060	1m4uA.pdb.gz
18	PDB:2k8pA	0.325	0.290	8.864E-2	189	0.117	0.101	2k8pA.pdb.gz
19	PDB:5ffoG	0.322	0.193	4.314E-1	297	0.055	0.030	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
20	PDB:5hk5F	0.196	0.229	4.831E-1	129	0.086	0.109	5hk5F.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96PD4	3.81e-121	340	163	1.000	1.000	IL17F_HUMAN Interleukin-17F OS=Homo sapiens OX=9606 GN=IL17F PE=1 SV=3
2	Q7TNI7	1.67e-56	176	161	0.552	0.559	IL17F_MOUSE Interleukin-17F OS=Mus musculus OX=10090 GN=Il17f PE=1 SV=1
3	Q16552	9.83e-37	125	155	0.374	0.394	IL17_HUMAN Interleukin-17A OS=Homo sapiens OX=9606 GN=IL17A PE=1 SV=1
4	Q61453	9.29e-29	105	150	0.313	0.340	IL17_RAT Interleukin-17A OS=Rattus norvegicus OX=10116 GN=Il17a PE=2 SV=1
5	Q62386	1.25e-26	100	158	0.307	0.316	IL17_MOUSE Interleukin-17A OS=Mus musculus OX=10090 GN=Il17a PE=1 SV=1
6	Q5TKT0	3.52e-16	73.6	162	0.209	0.210	Q5TKT0_DANRE Interleukin 17_5 OS=Danio rerio OX=7955 GN=f3 PE=2 SV=1
7	Q9P0M4	1.36e-14	70.1	197	0.239	0.198	IL17C_HUMAN Interleukin-17C OS=Homo sapiens OX=9606 GN=IL17C PE=1 SV=1
8	Q8TAD2	1.41e-12	64.7	202	0.196	0.158	IL17D_HUMAN Interleukin-17D OS=Homo sapiens OX=9606 GN=IL17D PE=2 SV=1
9	Q9QXT6	2.04e-10	58.5	180	0.202	0.183	IL17B_MOUSE Interleukin-17B OS=Mus musculus OX=10090 GN=Il17b PE=2 SV=1
10	Q8K4C5	9.94e-10	57.0	194	0.227	0.191	IL17C_MOUSE Interleukin-17C OS=Mus musculus OX=10090 GN=Il17c PE=1 SV=1
11	Q5TKT1	2.58e-09	55.8	212	0.184	0.142	Q5TKT1_DANRE Interleukin 17_4 OS=Danio rerio OX=7955 GN=zgc:194303 PE=2 SV=1
12	Q5TKT2	5.72e-09	54.3	167	0.227	0.222	Q5TKT2_DANRE Interleukin 17_3 OS=Danio rerio OX=7955 GN=il17c PE=3 SV=1
13	D3ZLB1	3.68e-08	52.4	169	0.209	0.201	D3ZLB1_RAT Interleukin 25 OS=Rattus norvegicus OX=10116 GN=Il25 PE=3 SV=1
14	Q8VHH8	1.19e-07	50.8	169	0.202	0.195	IL25_MOUSE Interleukin-25 OS=Mus musculus OX=10090 GN=Il25 PE=2 SV=1
15	Q9UHF5	1.85e-07	50.4	180	0.202	0.183	IL17B_HUMAN Interleukin-17B OS=Homo sapiens OX=9606 GN=IL17B PE=2 SV=1
16	Q70I21	5.38e-06	45.8	146	0.190	0.212	Q70I21_ONCMY Interleukin 17 isoform A OS=Oncorhynchus mykiss OX=8022 GN=il-17A PE=2 SV=1
17	Q9H293	1.52e-05	45.1	177	0.190	0.175	IL25_HUMAN Interleukin-25 OS=Homo sapiens OX=9606 GN=IL25 PE=1 SV=1
18	Q924W6	0.78	32.3	1344	0.098	0.012	TRI66_MOUSE Tripartite motif-containing protein 66 OS=Mus musculus OX=10090 GN=Trim66 PE=1 SV=4
19	O15016	2.0	31.2	1351	0.092	0.011	TRI66_HUMAN Tripartite motif-containing protein 66 OS=Homo sapiens OX=9606 GN=TRIM66 PE=1 SV=5
20	Q8IH18	3.0	30.4	1010	0.110	0.018	4ET_DROME Eukaryotic translation initiation factor 4E transporter OS=Drosophila melanogaster OX=7227 GN=4E-T PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06083 IL17	2.3e-25	100.1	Interleukin-17

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337432

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295981	0.999	Interleukin-17 receptor C
2	9606.ENSP00000320936	0.999	Interleukin-17 receptor A
3	9606.ENSP00000264657	0.990	Signal transducer and activator of transcription 3
4	9606.ENSP00000385675	0.976	Interleukin-6
5	9606.ENSP00000412237	0.973	Interleukin-10
6	9606.ENSP00000344192	0.972	Interleukin-17A
7	9606.ENSP00000228534	0.969	Interleukin-23 subunit alpha
8	9606.ENSP00000398698	0.956	Tumor necrosis factor
9	9606.ENSP00000362108	0.939	Neutrophil gelatinase-associated lipocalin
10	9606.ENSP00000478570	0.934	Vascular endothelial growth factor A
11	9606.ENSP00000221930	0.933	Transforming growth factor beta-1
12	9606.ENSP00000361405	0.929	Matrix metalloproteinase-9
13	9606.ENSP00000299855	0.928	Stromelysin-1
14	9606.ENSP00000384906	0.921	Serum amyloid A-1 protein
15	9606.ENSP00000249075	0.916	Leukemia inhibitory factor
16	9606.ENSP00000322788	0.915	Interstitial collagenase
17	9606.ENSP00000215781	0.914	Oncostatin-M
18	9606.ENSP00000218388	0.914	Metalloproteinase inhibitor 1
19	9606.ENSP00000264498	0.912	Fibroblast growth factor 2
20	9606.ENSP00000219070	0.910	72 kDa type IV collagenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019955	1.000	cytokine binding
GO:0042803	1.000	protein homodimerization activity
GO:0005125	1.000	cytokine activity
GO:0005126	0.455	cytokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.997	positive regulation of biological process
GO:0050896	0.996	response to stimulus
GO:0050794	0.995	regulation of cellular process
GO:0051239	0.993	regulation of multicellular organismal process
GO:0010468	0.993	regulation of gene expression
GO:0009987	0.992	cellular process
GO:0010604	0.990	positive regulation of macromolecule metabolic process
GO:0048583	0.988	regulation of response to stimulus
GO:0001819	0.980	positive regulation of cytokine production
GO:0007165	0.975	signal transduction
GO:0042221	0.963	response to chemical
GO:0032755	0.961	positive regulation of interleukin-6 production
GO:0048522	0.960	positive regulation of cellular process
GO:0080090	0.952	regulation of primary metabolic process
GO:0051171	0.949	regulation of nitrogen compound metabolic process
GO:0070887	0.932	cellular response to chemical stimulus
GO:0031323	0.920	regulation of cellular metabolic process
GO:0071310	0.915	cellular response to organic substance
GO:0032501	0.908	multicellular organismal process
GO:0050793	0.896	regulation of developmental process
GO:0051173	0.894	positive regulation of nitrogen compound metabolic process
GO:0007166	0.892	cell surface receptor signaling pathway
GO:0009966	0.874	regulation of signal transduction
GO:0034097	0.871	response to cytokine
GO:0071345	0.826	cellular response to cytokine stimulus
GO:0009889	0.800	regulation of biosynthetic process
GO:0048856	0.789	anatomical structure development
GO:0048519	0.775	negative regulation of biological process
GO:0032722	0.770	positive regulation of chemokine production
GO:0019221	0.764	cytokine-mediated signaling pathway
GO:2000026	0.749	regulation of multicellular organismal development
GO:1900015	0.708	regulation of cytokine production involved in inflammatory response
GO:0031326	0.700	regulation of cellular biosynthetic process
GO:0009605	0.682	response to external stimulus
GO:0051247	0.665	positive regulation of protein metabolic process
GO:0048584	0.638	positive regulation of response to stimulus
GO:0031325	0.635	positive regulation of cellular metabolic process
GO:2001141	0.615	regulation of RNA biosynthetic process
GO:0006355	0.611	regulation of DNA-templated transcription
GO:0006950	0.568	response to stress
GO:0009891	0.552	positive regulation of biosynthetic process
GO:0051707	0.512	response to other organism
GO:0031328	0.478	positive regulation of cellular biosynthetic process
GO:0002682	0.476	regulation of immune system process
GO:0010557	0.469	positive regulation of macromolecule biosynthetic process
GO:0051241	0.468	negative regulation of multicellular organismal process
GO:0080134	0.456	regulation of response to stress
GO:0045935	0.451	positive regulation of nucleobase-containing compound metabolic process
GO:0002376	0.440	immune system process
GO:0051254	0.437	positive regulation of RNA metabolic process
GO:0006952	0.429	defense response
GO:0002684	0.419	positive regulation of immune system process
GO:0032101	0.413	regulation of response to external stimulus
GO:1903508	0.393	positive regulation of nucleic acid-templated transcription
GO:0007275	0.375	multicellular organism development
GO:0032677	0.370	regulation of interleukin-8 production
GO:0022603	0.367	regulation of anatomical structure morphogenesis
GO:0031347	0.363	regulation of defense response
GO:0045893	0.355	positive regulation of DNA-templated transcription
GO:0090287	0.340	regulation of cellular response to growth factor stimulus
GO:0045765	0.331	regulation of angiogenesis
GO:0090092	0.309	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048731	0.305	system development
GO:0006357	0.303	regulation of transcription by RNA polymerase II
GO:1903555	0.300	regulation of tumor necrosis factor superfamily cytokine production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.796	extracellular space
GO:0005622	0.676	intracellular anatomical structure
GO:0043227	0.375	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]