StarFunc result for job id Q96PE1

User Input

>input (1338 residues)
MGAGGRRMRGAPARLLLPLLPWLLLLLAPEARGAPGCPLSIRSCKCSGERPKGLSGGVPG
PARRRVVCSGGDLPEPPEPGLLPNGTVTLLLSNNKITGLRNGSFLGLSLLEKLDLRNNII
STVQPGAFLGLGELKRLDLSNNRIGCLTSETFQGLPRLLRLNISGNIFSSLQPGVFDELP
ALKVVDLGTEFLTCDCHLRWLLPWAQNRSLQLSEHTLCAYPSALHAQALGSLQEAQLCCE
GALELHTHHLIPSLRQVVFQGDRLPFQCSASYLGNDTRIRWYHNRAPVEGDEQAGILLAE
SLIHDCTFITSELTLSHIGVWASGEWECTVSMAQGNASKKVEIVVLETSASYCPAERVAN
NRGDFRWPRTLAGITAYQSCLQYPFTSVPLGGGAPGTRASRRCDRAGRWEPGDYSHCLYT
NDITRVLYTFVLMPINASNALTLAHQLRVYTAEAASFSDMMDVVYVAQMIQKFLGYVDQI
KELVEVMVDMASNLMLVDEHLLWLAQREDKACSRIVGALERIGGAALSPHAQHISVNARN
VALEAYLIKPHSYVGLTCTAFQRREGGVPGTRPGSPGQNPPPEPEPPADQQLRFRCTTGR
PNVSLSSFHIKNSVALASIQLPPSLFSSLPAALAPPVPPDCTLQLLVFRNGRLFHSHSNT
SRPGAAGPGKRRGVATPVIFAGTSGCGVGNLTEPVAVSLRHWAEGAEPVAAWWSQEGPGE
AGGWTSEGCQLRSSQPNVSALHCQHLGNVAVLMELSAFPREVGGAGAGLHPVVYPCTALL
LLCLFATIITYILNHSSIRVSRKGWHMLLNLCFHIAMTSAVFAGGITLTNYQMVCQAVGI
TLHYSSLSTLLWMGVKARVLHKELTWRAPPPQEGDPALPTPSPMLRFYLIAGGIPLIICG
ITAAVNIHNYRDHSPYCWLVWRPSLGAFYIPVALILLITWIYFLCAGLRLRGPLAQNPKA
GNSRASLEAGEELRGSTRLRGSGPLLSDSGSLLATGSARVGTPGPPEDGDSLYSPGVQLG
ALVTTHFLYLAMWACGALAVSQRWLPRVVCSCLYGVAASALGLFVFTHHCARRRDVRASW
RACCPPASPAAPHAPPRALPAAAEDGSPVFGEGPPSLKSSPSGSSGHPLALGPCKLTNLQ
LAQSQVCEAGAAAGGEGEPEPAGTRGNLAHRHPNNVHHGRRAHKSRAKGHRAGEACGKNR
LKALRGGAAGALELLSSESGSLHNSPTDSYLGSSRNSPGAGLQLEGEPMLTPSEGSDTSA
APLSEAGRAGQRRSASRDSLKGGGALEKESHRRSYPLNAASLNGAPKGGKYDDVTLMGAE
VASGGCMKTGLWKSETTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7FBY6	0.640	0.628	0.000	1367	0.515	0.504	E7FBY6.pdb.gz	AGRA2_DANRE Adhesion G protein-coupled receptor A2 OS=Danio rerio OX=7955 GN=adgra2 PE=1 SV=2
2	AFDB:Q91ZV8	0.586	0.586	0.000	1336	0.879	0.880	Q91ZV8.pdb.gz	AGRA2_MOUSE Adhesion G protein-coupled receptor A2 OS=Mus musculus OX=10090 GN=Adgra2 PE=1 SV=2
3	AFDB:Q96PE1	1.000	1.000	0.000	1338	1.000	1.000	Q96PE1.pdb.gz	AGRA2_HUMAN Adhesion G protein-coupled receptor A2 OS=Homo sapiens OX=9606 GN=ADGRA2 PE=1 SV=2
4	AFDB:O95490	0.202	0.188	2.993E-35	1459	0.143	0.131	O95490.pdb.gz	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
5	AFDB:F1R8J2	0.205	0.144	3.791E-32	2014	0.137	0.091	F1R8J2.pdb.gz
6	AFDB:Q86SQ6	0.206	0.476	4.186E-32	560	0.176	0.421	Q86SQ6.pdb.gz	AGRA1_HUMAN Adhesion G protein-coupled receptor A1 OS=Homo sapiens OX=9606 GN=ADGRA1 PE=2 SV=3
7	AFDB:Q8C4G9	0.201	0.451	1.521E-31	578	0.169	0.391	Q8C4G9.pdb.gz	AGRA1_MOUSE Adhesion G protein-coupled receptor A1 OS=Mus musculus OX=10090 GN=Adgra1 PE=2 SV=1
8	PDB:5y31B	0.135	0.330	1.645E-12	511	0.052	0.135	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
9	AFDB:Q3V1M1	0.137	0.080	6.988E-11	2594	0.152	0.078	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
10	AFDB:Q6WRH9	0.115	0.066	1.102E-8	2597	0.139	0.072	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
11	AFDB:Q9W213	0.061	0.059	2.436E-8	1395	0.090	0.087	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
12	PDB:4k5yC	0.144	0.658	1.028E-6	248	0.038	0.206	4k5yC.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.
13	PDB:4edqA	0.067	0.181	3.923E-6	483	0.012	0.033	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
14	PDB:1xcdA	0.092	0.386	7.857E-6	305	0.037	0.161	1xcdA.pdb.gz
15	PDB:7tynR	0.145	0.446	1.919E-5	373	0.030	0.107	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
16	PDB:7wv3A	0.106	0.203	2.854E-5	668	0.033	0.066	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
17	PDB:7vqxR	0.150	0.494	3.658E-5	361	0.034	0.125	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
18	PDB:3t6qA	0.108	0.235	1.203E-4	601	0.031	0.070	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
19	PDB:6dldD	0.067	0.284	1.329E-4	269	0.016	0.082	6dldD.pdb.gz
20	PDB:5hhmI	0.067	0.365	1.542E-4	196	0.013	0.092	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0U2ULT4	0.0	1194	1367	0.519	0.508	A0A0U2ULT4_DANRE Adhesion G protein-coupled receptor A2 precursor OS=Danio rerio OX=7955 GN=adgra2 PE=1 SV=1
2	E7FBY6	0.0	1196	1367	0.520	0.509	AGRA2_DANRE Adhesion G protein-coupled receptor A2 OS=Danio rerio OX=7955 GN=adgra2 PE=1 SV=2
3	Q7TT36	0.0	949	1310	0.420	0.429	AGRA3_MOUSE Adhesion G protein-coupled receptor A3 OS=Mus musculus OX=10090 GN=Adgra3 PE=2 SV=3
4	Q8IWK6	0.0	943	1321	0.421	0.426	AGRA3_HUMAN Adhesion G protein-coupled receptor A3 OS=Homo sapiens OX=9606 GN=ADGRA3 PE=1 SV=2
5	Q91ZV8	0.0	2269	1336	0.877	0.879	AGRA2_MOUSE Adhesion G protein-coupled receptor A2 OS=Mus musculus OX=10090 GN=Adgra2 PE=1 SV=2
6	Q96PE1	0.0	2707	1338	1.000	1.000	AGRA2_HUMAN Adhesion G protein-coupled receptor A2 OS=Homo sapiens OX=9606 GN=ADGRA2 PE=1 SV=2
7	S4X0Q8	0.0	877	1346	0.403	0.400	AGRA3_DANRE Adhesion G protein-coupled receptor A3 OS=Danio rerio OX=7955 GN=adgra3 PE=1 SV=1
8	Q86SQ6	2.04e-98	328	560	0.179	0.429	AGRA1_HUMAN Adhesion G protein-coupled receptor A1 OS=Homo sapiens OX=9606 GN=ADGRA1 PE=2 SV=3
9	Q8C4G9	3.83e-91	308	578	0.178	0.412	AGRA1_MOUSE Adhesion G protein-coupled receptor A1 OS=Mus musculus OX=10090 GN=Adgra1 PE=2 SV=1
10	Q6P1C6	1.48e-24	114	1117	0.057	0.068	LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus OX=10090 GN=Lrig3 PE=1 SV=1
11	Q6UXM1	1.38e-23	110	1119	0.058	0.069	LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens OX=9606 GN=LRIG3 PE=1 SV=1
12	Q8IZF6	3.43e-23	110	3080	0.090	0.039	AGRG4_HUMAN Adhesion G-protein coupled receptor G4 OS=Homo sapiens OX=9606 GN=ADGRG4 PE=1 SV=2
13	Q8JZZ7	1.06e-21	105	1487	0.081	0.073	AGRL2_MOUSE Adhesion G protein-coupled receptor L2 OS=Mus musculus OX=10090 GN=Adgrl2 PE=1 SV=3
14	O94898	1.78e-21	103	1065	0.061	0.077	LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens OX=9606 GN=LRIG2 PE=1 SV=3
15	Q52KR2	7.18e-21	102	1054	0.060	0.076	LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus OX=10090 GN=Lrig2 PE=1 SV=1
16	O88923	1.27e-20	101	1487	0.073	0.066	AGRL2_RAT Adhesion G protein-coupled receptor L2 OS=Rattus norvegicus OX=10116 GN=Adgrl2 PE=1 SV=2
17	Q80TS3	6.72e-20	99.4	1537	0.072	0.062	AGRL3_MOUSE Adhesion G protein-coupled receptor L3 OS=Mus musculus OX=10090 GN=Adgrl3 PE=1 SV=3
18	Q9Z173	8.40e-20	99.0	1550	0.072	0.062	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
19	F1R9W4	1.08e-19	99.0	3044	0.065	0.029	F1R9W4_DANRE Cadherin EGF LAG seven-pass G-type receptor 1 isoform X2 OS=Danio rerio OX=7955 GN=celsr1a PE=1 SV=3
20	Q96JA1	1.20e-19	98.2	1093	0.053	0.065	LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens OX=9606 GN=LRIG1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	9.7e-07	39.9	7 transmembrane receptor (Secretin family)
2	PF01825 GPS	0.055	25.4	GPCR proteolysis site, GPS, motif
3	PF02793 HRM	0.46	22.1	Hormone receptor domain
4	PF07679 I-set	9.8	17.7	Immunoglobulin I-set domain
5	PF00047 ig	10	17.7	Immunoglobulin domain
6	PF13927 Ig_3	4.3	19.3	Immunoglobulin domain
7	PF16920 LRRCT_2	1.6e+02	13.7	Leucine rich repeat C-terminal motif
8	PF00560 LRR_1	0.016	26.4	Leucine Rich Repeat
9	PF12799 LRR_4	8.9e-07	40.4	Leucine Rich repeats (2 copies)
10	PF13306 LRR_5	21	16.5	BspA type Leucine rich repeat region (6 copies)
11	PF13855 LRR_8	1.1e-19	81.2	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406367

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294304	0.922	Low-density lipoprotein receptor-related protein 5
2	9606.ENSP00000261023	0.918	Integrin alpha-V
3	9606.ENSP00000452786	0.903	Integrin beta-3
4	9606.ENSP00000367202	0.828	Reversion-inducing cysteine-rich protein with Kazal motifs
5	9606.ENSP00000344456	0.811	Catenin beta-1
6	9606.ENSP00000345731	0.807	Disks large homolog 1
7	9606.ENSP00000285018	0.804	Protein Wnt-7a
8	9606.ENSP00000434034	0.803	Frizzled-4
9	9606.ENSP00000261349	0.777	Low-density lipoprotein receptor-related protein 6
10	9606.ENSP00000367301	0.775	Norrin
11	9606.ENSP00000225512	0.768	Proto-oncogene Wnt-3
12	9606.ENSP00000298910	0.742	Leucine-rich repeat serine/threonine-protein kinase 2
13	9606.ENSP00000324806	0.734	Glycogen synthase kinase-3 beta
14	9606.ENSP00000257430	0.724	Adenomatous polyposis coli protein
15	9606.ENSP00000323927	0.716	Plexin domain-containing protein 1
16	9606.ENSP00000222747	0.715	Tetraspanin-12
17	9606.ENSP00000265441	0.660	Protein Wnt-2
18	9606.ENSP00000341032	0.645	Protein Wnt-7b
19	9606.ENSP00000308117	0.641	Endosialin
20	9606.ENSP00000240123	0.627	Vinexin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004930	1.000	G protein-coupled receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0007165	0.988	signal transduction
GO:0048518	0.956	positive regulation of biological process
GO:0048583	0.945	regulation of response to stimulus
GO:0048522	0.940	positive regulation of cellular process
GO:0009966	0.933	regulation of signal transduction
GO:0048584	0.923	positive regulation of response to stimulus
GO:0030177	0.880	positive regulation of Wnt signaling pathway
GO:0060828	0.871	regulation of canonical Wnt signaling pathway
GO:0090263	0.767	positive regulation of canonical Wnt signaling pathway
GO:0007186	0.739	G protein-coupled receptor signaling pathway
GO:0048731	0.622	system development
GO:0048519	0.370	negative regulation of biological process
GO:0007399	0.363	nervous system development
GO:0048523	0.341	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0032991	0.993	protein-containing complex
GO:0005886	0.991	plasma membrane
GO:0009986	0.757	cell surface
GO:1990909	0.725	Wnt signalosome
GO:0005622	0.599	intracellular anatomical structure
GO:0043231	0.574	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]