StarFunc result for job id Q96PE2

User Input

>input (2063 residues)
MADGAPRPQLYRSVSFKLLERWSGGPGLREEDTDTPGLRRRASCRPTTAARGQPSRRVSK
LASGPLAAPAQPRPLRSLSPSVRQLSRRFDAPRLDDGSAGTRDGGVLPAAAEEAAEGPAR
GAWPSVTEMRKLFGGPGSRRPSADSESPGTPSPDGAAWEPPARESRQPPTPPPRTCFPLA
GLRSARPLTGPETEGRLRRPQQQQERAQRPADGLHSWHIFSQPQAGARASCSSSSIAASY
PVSRSRAASSSEEEEEGPPQLPGAQSPAYHGGHSSGSDDDRDGEGGHRWGGRPGLRPGSS
LLDQDCRPDSDGLNLSSMNSAGVSGSPEPPTSPRAPREEGLREWGSGSPPCVPGPQEGLR
PMSDSVGGAFRVAKVSFPSYLASPAGSRGSSRYSSTETLKDDDLWSSRGSGGWGVYRSPS
FGAGEGLLRSQARTRAKGPGGTSRALRDGGFEPEKSRQRKSLSNPDIASETLTLLSFLRS
DLSELRVRKPGGSSGDRGSNPLDGRDSPSAGGPVGQLEPIPIPAPASPGTRPTLKDLTAT
LRRAKSFTCSEKPMARRLPRTSALKSSSSELLLTGPGAEEDPLPLIVQDQYVQEARQVFE
KIQRMGAQQDDGSDAPPGSPDWAGDVTRGQRSQEELSGPESSLTDEGIGADPEPPVAAFC
GLGTTGMWRPLSSSSAQTNHHGPGTEDSLGGWALVSPETPPTPGALRRRRKVPPSGSGGS
ELSNGEAGEAYRSLSDPIPQRHRAATSEEPTGFSVDSNLLGSLSPKTGLPATSAMDEGLT
SGHSDWSVGSEESKGYQEVIQSIVQGPGTLGRVVDDRIAGKAPKKKSLSDPSRRGELAGP
GFEGPGGEPIREVEPMLPPSSSEPILVEQRAEPEEPGATRSRAQSERALPEALPPPATAH
RNFHLDPKLADILSPRLIRRGSKKRPARSSHQELRRDEGSQDQTGSLSRARPSSRHVRHA
SVPATFMPIVVPEPPTSVGPPVAVPEPIGFPTRAHPTLQAPSLEDVTKQYMLNLHSGEVP
APVPVDMPCLPLAAPPSAEAKPPEAARPADEPTPASKCCSKPQVDMRKHVAMTLLDTEQS
YVESLRTLMQGYMQPLKQPENSVLCDPSLVDEIFDQIPELLEHHEQFLEQVRHCMQTWHA
QQKVGALLVQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRENKEKQ
ALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPLLLEAQRNIKQVAERINKGVRSAEE
AERHARVLQEIEAHIEGMEDLQAPLRRFLRQEMVIEVKAIGGKKDRSLFLFTDLIVCTTL
KRKSGSLRRSSMSLYTAASVIDTASKYKMLWKLPLEDADIIKGASQATNRENIQKAISRL
DEDLTTLGQMSKLSESLGFPHQSLDDALRDLSAAMHRDLSEKQALCYALSFPPTKLELCA
TRPEGTDSYIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQFS
CAAPTLNSCPEPSPEVWVCNSDGYVGQVCLLSLRAEPDVEACIAVCSARILCIGAVPGLQ
PRCHREPPPSLRSPPETAPEPAGPELDVEAAADEEAATLAEPGPQPCLHISIAGSGLEMT
PGLGEGDPRPELVPFDSDSDDESSPSPSGTLQSQASRSTISSSFGNEETPSSKEATAETT
SSEEEQEPGFLPLSGSFGPGGPCGTSPMDGRALRRSSHGSFTRGSLEDLLSVDPEAYQSS
VWLGTEDGCVHVYQSSDSIRDRRNSMKLQHAASVTCILYLNNQVFVSLANGELVVYQREA
GHFWDPQNFKSVTLGTQGSPITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHMFYVGQDSS
RCVACMVDSSLGVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAA
CLRITALLVCEELLWVGTSAGVVLTMPTSPGTVSCPRAPLSPTGLGQGHTGHVRFLAAVQ
LPDGFNLLCPTPPPPPDTGPEKLPSLEHRDSPWHRGPAPARPKMLVISGGDGYEDFRLSS
GGGSSSETVGRDDSTNHLLLWRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96PE2	1.000	1.000	0.000	2063	1.000	1.000	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
2	AFDB:M9PHU0	0.148	0.136	2.068E-50	2263	0.167	0.152	M9PHU0.pdb.gz	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
3	AFDB:X2JC00	0.103	0.139	1.331E-22	1404	0.095	0.140	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
4	AFDB:Q6ZNL6	0.085	0.119	5.847E-16	1462	0.119	0.168	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
5	AFDB:E9Q7D5	0.135	0.172	5.452E-15	1581	0.114	0.149	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
6	AFDB:Q9VW85	0.139	0.169	8.766E-15	1661	0.130	0.162	Q9VW85.pdb.gz	Q9VW85_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=1 SV=4
7	PDB:7rx9A	0.087	0.398	1.769E-14	432	0.040	0.190	7rx9A.pdb.gz
8	AFDB:Q12774	0.135	0.170	4.408E-14	1597	0.126	0.162	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
9	PDB:4mt6A	0.123	0.465	7.015E-14	389	0.030	0.157	4mt6A.pdb.gz
10	AFDB:Q9VZ85	0.116	0.120	6.177E-10	1984	0.125	0.130	Q9VZ85.pdb.gz	Q9VZ85_DROME Rho guanine nucleotide exchange factor at 64C, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGEF64C PE=4 SV=2
11	PDB:6xr4A	0.104	0.201	2.795E-9	1040	0.023	0.045	6xr4A.pdb.gz
12	PDB:7lhwA	0.148	0.167	2.931E-9	1813	0.037	0.042	7lhwA.pdb.gz	Structural analysis of the full-length human LRRK2.
13	AFDB:Q9H2Y7	0.095	0.103	5.237E-9	1883	0.137	0.150	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
14	AFDB:O88466	0.094	0.102	8.031E-9	1888	0.141	0.154	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
15	PDB:7ajuCH	0.097	0.339	9.611E-9	467	0.020	0.088	7ajuCH.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:5jpqY	0.097	0.429	5.844E-8	365	0.016	0.093	5jpqY.pdb.gz	Architecture of the 90S Pre-ribosome: A Structural View on the Birth of the Eukaryotic Ribosome.
17	PDB:3zwlD	0.098	0.516	6.739E-8	352	0.016	0.097	3zwlD.pdb.gz
18	PDB:7wb4c	0.098	0.502	9.397E-8	346	0.016	0.092	7wb4c.pdb.gz
19	PDB:6ttuT	0.096	0.451	1.374E-7	394	0.022	0.114	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
20	PDB:7mq8SG	0.099	0.467	1.511E-7	389	0.016	0.087	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96PE2	0.0	4151	2063	1.000	1.000	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
2	Q21653	9.83e-72	266	1182	0.083	0.145	OSG1_CAEEL Rho guanine nucleotide exchange factor osg-1 OS=Caenorhabditis elegans OX=6239 GN=osg-1 PE=2 SV=4
3	O15013	2.79e-42	173	1369	0.072	0.108	ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4
4	Q9HCE6	3.00e-38	160	1279	0.050	0.081	ARGAL_HUMAN Rho guanine nucleotide exchange factor 10-like protein OS=Homo sapiens OX=9606 GN=ARHGEF10L PE=1 SV=4
5	O60271	2.24e-35	150	1321	0.051	0.080	JIP4_HUMAN C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4
6	Q58A65	7.02e-35	149	1321	0.051	0.079	JIP4_MOUSE C-Jun-amino-terminal kinase-interacting protein 4 OS=Mus musculus OX=10090 GN=Spag9 PE=1 SV=2
7	A0A8I6B3N0	1.42e-34	147	1321	0.052	0.081	A0A8I6B3N0_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
8	A0A8I6A5S1	3.75e-34	146	1178	0.052	0.091	A0A8I6A5S1_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
9	A0A8I6B484	3.81e-34	146	1169	0.052	0.092	A0A8I6B484_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
10	A0A8I5ZJK4	5.34e-33	142	1334	0.052	0.080	A0A8I5ZJK4_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
11	A0A8I6AXC7	5.45e-33	142	1305	0.052	0.082	A0A8I6AXC7_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
12	E9PSJ4	6.02e-33	142	1324	0.052	0.081	E9PSJ4_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=3
13	A0A8I5Y1R0	6.04e-33	142	1305	0.052	0.082	A0A8I5Y1R0_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
14	A0A0G2K6E8	2.55e-32	140	1352	0.051	0.078	A0A0G2K6E8_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
15	Q9GQF1	2.84e-32	140	1227	0.047	0.078	JIP3_DROME JNK-interacting protein 3 OS=Drosophila melanogaster OX=7227 GN=syd PE=1 SV=1
16	Q9UPT6	6.45e-32	139	1336	0.053	0.082	JIP3_HUMAN C-Jun-amino-terminal kinase-interacting protein 3 OS=Homo sapiens OX=9606 GN=MAPK8IP3 PE=1 SV=3
17	P11274	1.62e-31	137	1271	0.048	0.077	BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2
18	F1LXF1	1.70e-31	137	1270	0.048	0.077	BCR_RAT Breakpoint cluster region protein OS=Rattus norvegicus OX=10116 GN=Bcr PE=1 SV=4
19	M9PHU0	1.42e-30	135	2263	0.043	0.039	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
20	Q6PAJ1	2.54e-30	134	1270	0.047	0.076	BCR_MOUSE Breakpoint cluster region protein OS=Mus musculus OX=10090 GN=Bcr PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14783 BBS2_Mid	1.3e+02	14.1	Ciliary BBSome complex subunit 2, middle region
2	PF07083 DUF1351	1.1e+02	13.9	Protein of unknown function (DUF1351)
3	PF19057 PH_19	1.9e-17	74.8	PH domain
4	PF00621 RhoGEF	2.4e-38	143.7	RhoGEF domain
5	PF19056 WD40_2	1.6e-49	180.5	WD40 repeated domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263674

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.945	Transforming protein RhoA
2	9606.ENSP00000027335	0.756	Cadherin-17
3	9606.ENSP00000323927	0.714	Plexin domain-containing protein 1
4	9606.ENSP00000340297	0.631	Rho guanine nucleotide exchange factor 10
5	9606.ENSP00000308117	0.620	Endosialin
6	9606.ENSP00000355060	0.609	Rho guanine nucleotide exchange factor 10-like protein
7	9606.ENSP00000216127	0.608	GTP-binding protein Rhes
8	9606.ENSP00000358815	0.592	E3 ubiquitin-protein ligase NEURL1B
9	9606.ENSP00000229758	0.584	F-box only protein 5
10	9606.ENSP00000380942	0.582	Rho guanine nucleotide exchange factor 12
11	9606.ENSP00000383118	0.569	Cell division control protein 42 homolog
12	9606.ENSP00000355026	0.562	Rho guanine nucleotide exchange factor 15
13	9606.ENSP00000278572	0.547	40S ribosomal protein S3
14	9606.ENSP00000006658	0.543	Spermatogenesis-associated protein 20
15	9606.ENSP00000260302	0.541	Collagenase 3
16	9606.ENSP00000220062	0.522	Ras-like protein family member 12
17	9606.ENSP00000386722	0.516	FCH and double SH3 domains 2
18	9606.ENSP00000441913	0.514	Rho guanine nucleotide exchange factor 28
19	9606.ENSP00000265748	0.512	Anillin
20	9606.ENSP00000446093	0.512	Gamma-tubulin complex component 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0019899	0.382	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0051056	0.989	regulation of small GTPase mediated signal transduction
GO:0007010	0.975	cytoskeleton organization
GO:0030029	0.885	actin filament-based process
GO:0030036	0.589	actin cytoskeleton organization
GO:0048518	0.384	positive regulation of biological process
GO:0048522	0.344	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.949	organelle
GO:0043229	0.718	intracellular organelle
GO:0043227	0.706	membrane-bounded organelle
GO:0043231	0.455	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]