StarFunc result for job id Q96PE3

User Input

>input (977 residues)
MTAREHSPRHGARARAMQRASTIDVAADMLGLSLAGNIQDPDEPILEFSLACSELHTPSL
DRKPNSFVAVSVTTPPQAFWTKHAQTEIIEGTNNPIFLSSIAFFQDSLINQMTQVKLSVY
DVKDRSQGTMYLLGSGTFIVKDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQR
PPVTRSVDTVNGRMVLPVDESLTEALGIRSKYASLRKDTLLKSVFGGAICRMYRFPTTDG
NHLRILEQMAESVLSLHVPRQFVKLLLEEDAARVCELEELGELSPCWESLRRQIVTQYQT
IILTYQENLTDLHQYRGPSFKASSLKADKKLEFVPTNLHIQRMRVQDDGGSDQNYDIVTI
GAPAAHCQGFKSGGLRKKLHKFEETKKHFEECCTSSGCQSIIYIPQDVVRAKEIIAQINT
LKTQVSYYAERLSRAAKDRSATGLERTLAILADKTRQLVTVCDCKLLANSIHGLNAARPD
YIASKASPTSTEEEQVMLRNDQDTLMARWTGRNSRSSLQVDWHEEEWEKVWLNVDKSLEC
IIQRVDKLLQKERLHGEGCEDVFPCAGSCTSKKGNPDSHAYWIRPEDPFCDVPSSPCPST
MPSTACHPHLTTHCSPPPEESSPGEWSEALYPLLTTLTDCVAMMSDKAKKAMVFLLMQDS
APTIATYLSLQYRRDVVFCQTLTALICGFIIKLRNCLHDDGFLRQLYTIGLLAQFESLLS
TYGEELAMLEDMSLGIMDLRNVTFKVTQATSSASADMLPVITGNRDGFNVRVPLPGPLFD
ALPREIQSGMLLRVQPVLFNVGINEQQTLAERFGDTSLQEVINVESLVRLNSYFEQFKEV
LPEDCLPRSRSQTCLPELLRFLGQNVHARKNKNVDILWQAAEICRRLNGVRFTSCKSAKD
RTAMSVTLEQCLILQHEHGMAPQVFTQALECMRSEGCRRENTMKNVGSRKYAFNSLQLKA
FPKHYRPPEGTYGKVET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q62784	0.913	0.949	0.000	939	0.928	0.966	Q62784.pdb.gz	INP4A_RAT Inositol polyphosphate-4-phosphatase type I A OS=Rattus norvegicus OX=10116 GN=Inpp4a PE=1 SV=1
2	AFDB:Q96PE3	1.000	1.000	0.000	977	1.000	1.000	Q96PE3.pdb.gz	INP4A_HUMAN Inositol polyphosphate-4-phosphatase type I A OS=Homo sapiens OX=9606 GN=INPP4A PE=1 SV=1
3	AFDB:Q9QWG5	0.773	0.812	3.683E-83	928	0.422	0.444	Q9QWG5.pdb.gz	INP4B_RAT Type II inositol 3,4-bisphosphate 4-phosphatase OS=Rattus norvegicus OX=10116 GN=Inpp4b PE=1 SV=1
4	PDB:6pcvA	0.373	0.479	2.167E-16	754	0.129	0.167	6pcvA.pdb.gz
5	AFDB:Q86YQ8	0.127	0.214	1.787E-6	564	0.029	0.050	Q86YQ8.pdb.gz	CPNE8_HUMAN Copine-8 OS=Homo sapiens OX=9606 GN=CPNE8 PE=1 SV=2
6	AFDB:Q8JZW4	0.121	0.193	3.279E-6	593	0.031	0.051	Q8JZW4.pdb.gz	CPNE5_MOUSE Copine-5 OS=Mus musculus OX=10090 GN=Cpne5 PE=1 SV=1
7	AFDB:Q5JX45	0.116	0.282	4.253E-6	386	0.019	0.049	Q5JX45.pdb.gz	Q5JX45_HUMAN Copine 1 (Fragment) OS=Homo sapiens OX=9606 GN=CPNE1 PE=1 SV=1
8	AFDB:Q8IYJ1	0.120	0.208	4.638E-6	553	0.029	0.051	Q8IYJ1.pdb.gz	CPNE9_HUMAN Copine-9 OS=Homo sapiens OX=9606 GN=CPNE9 PE=1 SV=3
9	AFDB:B0QZ18	0.116	0.206	1.495E-5	542	0.020	0.037	B0QZ18.pdb.gz	B0QZ18_HUMAN Copine 1 OS=Homo sapiens OX=9606 GN=CPNE1 PE=1 SV=1
10	PDB:6kxkD	0.123	0.211	2.054E-5	553	0.026	0.045	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
11	PDB:5ixcA	0.099	0.138	1.957E-4	684	0.019	0.028	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
12	AFDB:Q52KB6	0.099	0.046	2.105E-4	2323	0.077	0.032	Q52KB6.pdb.gz	C2CD3_MOUSE C2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=C2cd3 PE=1 SV=3
13	PDB:5iz5B	0.102	0.131	3.293E-4	746	0.019	0.025	5iz5B.pdb.gz
14	PDB:5izrC	0.097	0.140	3.439E-4	659	0.018	0.027	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	AFDB:Q54CA8	0.105	0.060	3.541E-4	2147	0.102	0.047	Q54CA8.pdb.gz	Q54CA8_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizB PE=3 SV=1
16	PDB:1cjyA	0.100	0.149	4.460E-4	633	0.019	0.030	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
17	PDB:5iz5A	0.097	0.123	8.925E-4	757	0.018	0.024	5iz5A.pdb.gz
18	PDB:5a50A	0.107	0.518	1.568E-3	165	0.021	0.127	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:7lq1A	0.101	0.103	2.419E-3	950	0.045	0.046	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
20	PDB:3pfqA	0.085	0.147	2.638E-3	523	0.029	0.054	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15327	0.0	734	924	0.424	0.448	INP4B_HUMAN Inositol polyphosphate 4-phosphatase type II OS=Homo sapiens OX=9606 GN=INPP4B PE=1 SV=4
2	Q62784	0.0	1877	939	0.928	0.966	INP4A_RAT Inositol polyphosphate-4-phosphatase type I A OS=Rattus norvegicus OX=10116 GN=Inpp4a PE=1 SV=1
3	Q6P1Y8	0.0	683	924	0.396	0.419	INP4B_MOUSE Type II inositol 3,4-bisphosphate 4-phosphatase OS=Mus musculus OX=10090 GN=Inpp4b PE=2 SV=1
4	Q96PE3	0.0	2039	977	1.000	1.000	INP4A_HUMAN Inositol polyphosphate-4-phosphatase type I A OS=Homo sapiens OX=9606 GN=INPP4A PE=1 SV=1
5	Q9EPW0	0.0	1864	939	0.920	0.957	INP4A_MOUSE Inositol polyphosphate-4-phosphatase type I A OS=Mus musculus OX=10090 GN=Inpp4a PE=1 SV=1
6	Q9QWG5	0.0	734	928	0.419	0.441	INP4B_RAT Type II inositol 3,4-bisphosphate 4-phosphatase OS=Rattus norvegicus OX=10116 GN=Inpp4b PE=1 SV=1
7	Q70Z35	6.42e-29	127	1606	0.095	0.058	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
8	A0A8I6GLR6	1.06e-28	127	1646	0.105	0.063	A0A8I6GLR6_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=4 SV=1
9	D3ZS72	1.07e-28	127	1635	0.105	0.063	D3ZS72_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=1 SV=4
10	Q3LAC4	4.65e-28	125	1598	0.092	0.056	PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus OX=10090 GN=Prex2 PE=1 SV=2
11	Q69ZK0	5.18e-28	125	1650	0.104	0.062	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
12	Q8TCU6	2.41e-27	122	1659	0.103	0.061	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
13	F1R6J2	4.63e-24	112	1622	0.094	0.057	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
14	O14065	0.25	37.7	1429	0.029	0.020	YC31_SCHPO Uncharacterized protein C962.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC962.01 PE=2 SV=3
15	Q9UBL6	0.84	35.8	633	0.025	0.038	CPNE7_HUMAN Copine-7 OS=Homo sapiens OX=9606 GN=CPNE7 PE=1 SV=1
16	Q8IYJ1	1.3	35.4	553	0.026	0.045	CPNE9_HUMAN Copine-9 OS=Homo sapiens OX=9606 GN=CPNE9 PE=1 SV=3
17	Q8IWA4	1.4	35.0	741	0.017	0.023	MFN1_HUMAN Mitofusin-1 OS=Homo sapiens OX=9606 GN=MFN1 PE=1 SV=3
18	A0A499FJI4	2.0	35.0	4738	0.039	0.008	A0A499FJI4_HUMAN RCR-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 GN=MYCBP2 PE=1 SV=2
19	O75592	2.0	35.0	4678	0.039	0.008	MYCB2_HUMAN E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2 PE=1 SV=4
20	Q7TPH6	2.3	34.7	4749	0.039	0.008	MYCB2_MOUSE E3 ubiquitin-protein ligase MYCBP2 OS=Mus musculus OX=10090 GN=Mycbp2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	22	16.8	C2 domain
2	PF08788 NHR2	1.6e+02	13.5	NHR2 domain like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000074304

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298229	0.963	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
2	9606.ENSP00000230124	0.962	Polyphosphoinositide phosphatase
3	9606.ENSP00000360154	0.960	Inositol polyphosphate 5-phosphatase OCRL-1
4	9606.ENSP00000265970	0.954	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
5	9606.ENSP00000361021	0.953	Phosphatase and tensin homolog
6	9606.ENSP00000362115	0.950	Type II inositol 1,4,5-trisphosphate 5-phosphatase
7	9606.ENSP00000356155	0.948	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
8	9606.ENSP00000264380	0.947	1-phosphatidylinositol 3-phosphate 5-kinase
9	9606.ENSP00000413937	0.947	Inositol polyphosphate 5-phosphatase K
10	9606.ENSP00000262039	0.946	Phosphatidylinositol 3-kinase catalytic subunit type 3
11	9606.ENSP00000409667	0.946	Synaptojanin-1
12	9606.ENSP00000405338	0.944	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
13	9606.ENSP00000357583	0.942	Type I inositol 1,4,5-trisphosphate 5-phosphatase
14	9606.ENSP00000360777	0.941	72 kDa inositol polyphosphate 5-phosphatase
15	9606.ENSP00000373713	0.938	Phosphatidylinositide phosphatase SAC1
16	9606.ENSP00000347792	0.935	Synaptojanin-2
17	9606.ENSP00000376142	0.932	Inositol polyphosphate-1-phosphatase
18	9606.ENSP00000359423	0.928	Myotubularin
19	9606.ENSP00000428056	0.920	Phosphatidylinositol 3-kinase regulatory subunit alpha
20	9606.ENSP00000445381	0.916	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016316	1.000	phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity
GO:0005488	0.995	binding
GO:0005515	0.990	protein binding
GO:0052745	0.906	inositol phosphate phosphatase activity
GO:0046030	0.862	inositol trisphosphate phosphatase activity
GO:0052828	0.330	inositol-3,4-bisphosphate 4-phosphatase activity
GO:0017161	0.330	inositol-1,3,4-trisphosphate 4-phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0046488	0.985	phosphatidylinositol metabolic process
GO:0046474	0.984	glycerophospholipid biosynthetic process
GO:0044281	0.977	small molecule metabolic process
GO:0050794	0.977	regulation of cellular process
GO:0006661	0.957	phosphatidylinositol biosynthetic process
GO:0007154	0.940	cell communication
GO:0023052	0.924	signaling
GO:1901615	0.913	organic hydroxy compound metabolic process
GO:0051716	0.865	cellular response to stimulus
GO:0007165	0.796	signal transduction
GO:0019751	0.732	polyol metabolic process
GO:0043647	0.666	inositol phosphate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0012505	0.996	endomembrane system
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005654	0.994	nucleoplasm
GO:0016020	0.989	membrane
GO:0031090	0.954	organelle membrane
GO:0030054	0.606	cell junction
GO:0031975	0.537	envelope
GO:0031967	0.518	organelle envelope
GO:0005635	0.456	nuclear envelope
GO:0045202	0.378	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17193	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + phosphate
EC:3.1.3.66	1.000	phosphatidylinositol-3,4-bisphosphate 4-phosphatase.
RHEA:43392	0.330	1D-myo-inositol 1,3,4-trisphosphate + H2O = 1D-myo-inositol 1,3-bisphosphate + phosphate
RHEA:43388	0.330	1D-myo-inositol 3,4-bisphosphate + H2O = 1D-myo-inositol 3-phosphate + phosphate

[back to server]