StarFunc result for job id Q96PE7

User Input

>input (176 residues)
MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEK
AAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGM
HHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96PE7	1.000	1.000	3.838E-35	176	1.000	1.000	Q96PE7.pdb.gz	MCEE_HUMAN Methylmalonyl-CoA epimerase, mitochondrial OS=Homo sapiens OX=9606 GN=MCEE PE=1 SV=1
2	AFDB:Q9D1I5	0.861	0.852	1.513E-30	178	0.801	0.792	Q9D1I5.pdb.gz	MCEE_MOUSE Methylmalonyl-CoA epimerase, mitochondrial OS=Mus musculus OX=10090 GN=Mcee PE=1 SV=1
3	AFDB:G5EEG4	0.745	0.807	7.600E-22	162	0.551	0.599	G5EEG4.pdb.gz	G5EEG4_CAEEL Mitochondrial methylmalonyl-CoA epimerase OS=Caenorhabditis elegans OX=6239 GN=mce-1 PE=1 SV=1
4	AFDB:O58010	0.697	0.891	9.020E-15	136	0.284	0.368	O58010.pdb.gz	MCE_PYRHO Methylmalonyl-CoA epimerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=PH0272 PE=1 SV=1
5	AFDB:Q9I6P6	0.563	0.178	3.672E-8	634	0.233	0.065	Q9I6P6.pdb.gz	DSD_PSEAE 3-dehydroshikimate dehydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=quiC1 PE=3 SV=1
6	PDB:5ec3A	0.587	0.295	5.196E-8	376	0.148	0.069	5ec3A.pdb.gz	Structural insight into the catalyitc mechanism of human 4-Hydroxyphenylpyruvate dioxygenase
7	AFDB:C8VKK0	0.551	0.267	5.245E-8	401	0.165	0.072	C8VKK0.pdb.gz	C8VKK0_EMENI 4-hydroxyphenylpyruvate dioxygenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01899 PE=3 SV=1
8	AFDB:Q4WHU1	0.599	0.288	5.908E-8	403	0.182	0.079	Q4WHU1.pdb.gz	HPPD1_ASPFU 4-hydroxyphenylpyruvate dioxygenase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=hppD PE=1 SV=1
9	AFDB:O52791	0.590	0.307	8.440E-8	357	0.142	0.070	O52791.pdb.gz	HMAS_AMYOR 4-hydroxymandelate synthase OS=Amycolatopsis orientalis OX=31958 PE=1 SV=1
10	AFDB:Q8W593	0.316	0.169	8.957E-8	350	0.222	0.111	Q8W593.pdb.gz	LGUC_ARATH Probable lactoylglutathione lyase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g67280 PE=1 SV=1
11	PDB:1sqiB	0.598	0.328	1.194E-7	342	0.153	0.079	1sqiB.pdb.gz	Structural basis for herbicidal inhibitor selectivity revealed by comparison of crystal structures of plant and Mammalian 4-hydroxyphenylpyruvate dioxygenases
12	AFDB:Q88JU3	0.563	0.178	1.828E-7	635	0.210	0.058	Q88JU3.pdb.gz	DSD_PSEPK 3-dehydroshikimate dehydratase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=quiC1 PE=1 SV=1
13	PDB:1fa5A	0.292	0.394	2.437E-7	128	0.176	0.242	1fa5A.pdb.gz	Determination of the structure of Escherichia coli glyoxalase I suggests a structural basis for differential metal activation.
14	PDB:2r5vA	0.535	0.291	2.437E-7	346	0.176	0.090	2r5vA.pdb.gz	Two roads diverged: the structure of hydroxymandelate synthase from Amycolatopsis orientalis in complex with 4-hydroxymandelate.
15	PDB:7x5rA	0.556	0.272	3.334E-6	386	0.153	0.070	7x5rA.pdb.gz	Structural insights of 4-Hydrophenylpyruvate dioxygenase inhibition by structurally diverse small molecules
16	PDB:5xgkA	0.562	0.286	3.538E-6	368	0.142	0.068	5xgkA.pdb.gz	Crystal Structure of 4-Hydroxyphenylpyruvate Dioxygenase in Complex with Substrate Reveals a New Starting Point for Herbicide Discovery.
17	PDB:5hmqD	0.466	0.160	4.763E-6	624	0.176	0.050	5hmqD.pdb.gz	Structure of a putative xylose isomerase-like TIM barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein from Pseudomonas putida at 2.4 Angstroms resolution.
18	PDB:2zi8A	0.472	0.299	3.008E-5	299	0.142	0.084	2zi8A.pdb.gz	Studies of a ring-cleaving dioxygenase illuminate the role of cholesterol metabolism in the pathogenesis of Mycobacterium tuberculosis.
19	PDB:4kykA	0.289	0.285	3.388E-5	179	0.136	0.134	4kykA.pdb.gz	Zopolrestat as a human glyoxalase I inhibitor and its structural basis.
20	PDB:7wt0A	0.301	0.288	3.388E-5	185	0.188	0.178	7wt0A.pdb.gz	Crystal structures of human glyoxalase I and its complex with TLSC702 reveal inhibitor binding mode and substrate preference.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96PE7	1.31e-127	357	176	1.000	1.000	MCEE_HUMAN Methylmalonyl-CoA epimerase, mitochondrial OS=Homo sapiens OX=9606 GN=MCEE PE=1 SV=1
2	Q9D1I5	1.39e-94	273	178	0.784	0.775	MCEE_MOUSE Methylmalonyl-CoA epimerase, mitochondrial OS=Mus musculus OX=10090 GN=Mcee PE=1 SV=1
3	G5EEG4	3.92e-61	188	162	0.523	0.568	G5EEG4_CAEEL Mitochondrial methylmalonyl-CoA epimerase OS=Caenorhabditis elegans OX=6239 GN=mce-1 PE=1 SV=1
4	O58010	7.03e-28	103	136	0.290	0.375	MCE_PYRHO Methylmalonyl-CoA epimerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=PH0272 PE=1 SV=1
5	Q9SKZ0	8.41e-06	45.4	135	0.210	0.274	Q9SKZ0_ARATH At2g32090/F22D22.16 OS=Arabidopsis thaliana OX=3702 GN=GLXI-LIKE PE=1 SV=2
6	Q09751	9.04e-05	43.9	302	0.176	0.103	LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=glo1 PE=1 SV=1
7	Q9LTR8	1.52e-04	42.7	197	0.188	0.168	Q9LTR8_ARATH At5g57040 OS=Arabidopsis thaliana OX=3702 GN=GLXI-LIKE PE=1 SV=1
8	Q9I6P6	6.53e-04	41.6	634	0.176	0.049	DSD_PSEAE 3-dehydroshikimate dehydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=quiC1 PE=3 SV=1
9	P0AC81	0.001	39.7	135	0.142	0.185	LGUL_ECOLI Lactoylglutathione lyase OS=Escherichia coli (strain K12) OX=83333 GN=gloA PE=1 SV=1
10	Q88JU3	0.001	40.8	635	0.165	0.046	DSD_PSEPK 3-dehydroshikimate dehydratase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=quiC1 PE=1 SV=1
11	O65398	0.002	39.7	283	0.193	0.120	GLX1_ARATH Lactoylglutathione lyase GLX1 OS=Arabidopsis thaliana OX=3702 GN=GLX1 PE=1 SV=1
12	Q8W593	0.008	38.1	350	0.210	0.106	LGUC_ARATH Probable lactoylglutathione lyase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g67280 PE=1 SV=1
13	P50107	0.030	36.6	326	0.210	0.113	LGUL_YEAST Glyoxalase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLO1 PE=1 SV=1
14	Q9KWQ5	0.032	36.2	300	0.182	0.107	HSAC_RHOJR Iron-dependent extradiol dioxygenase OS=Rhodococcus jostii (strain RHA1) OX=101510 GN=hsaC PE=1 SV=1
15	Q9HU72	0.10	34.3	176	0.136	0.136	LGUL_PSEAE Lactoylglutathione lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=gloA PE=3 SV=1
16	O04818	0.68	32.3	285	0.182	0.112	O04818_SPOST lactoylglutathione lyase OS=Sporobolus stapfianus OX=56623 PE=2 SV=1
17	Q42891	0.84	32.0	185	0.199	0.189	LGUL_SOLLC Lactoylglutathione lyase OS=Solanum lycopersicum OX=4081 GN=GLX1 PE=2 SV=1
18	P9WNW7	1.2	31.6	300	0.165	0.097	HSAC_MYCTU Iron-dependent extradiol dioxygenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hsaC PE=1 SV=1
19	Q948T6	1.4	31.6	291	0.176	0.107	LGUL_ORYSJ Lactoylglutathione lyase OS=Oryza sativa subsp. japonica OX=39947 GN=GLYI-11 PE=1 SV=2
20	Q8GVE5	1.8	31.2	394	0.153	0.069	TLP2_ARATH Tubby-like F-box protein 2 OS=Arabidopsis thaliana OX=3702 GN=TULP2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00903 Glyoxalase	7.8e-09	47.2	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
2	PF12681 Glyoxalase_2	36	15.7	Glyoxalase-like domain
3	PF13468 Glyoxalase_3	0.0021	29.7	Glyoxalase-like domain
4	PF13669 Glyoxalase_4	6.4e-17	73.2	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
5	PF18029 Glyoxalase_6	54	15.9	Glyoxalase-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000244217

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274813	0.991	Methylmalonyl-CoA mutase, mitochondrial
2	9606.ENSP00000419027	0.985	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA . Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxy [...]
3	9606.ENSP00000365462	0.978	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
4	9606.ENSP00000436585	0.962	Ethylmalonyl-CoA decarboxylase
5	9606.ENSP00000479130	0.936	Acyl-CoA synthetase family member 3, mitochondrial
6	9606.ENSP00000281317	0.925	Methylmalonic aciduria type A protein, mitochondrial
7	9606.ENSP00000234454	0.916	Sepiapterin reductase
8	9606.ENSP00000389060	0.854	Methylmalonic aciduria and homocystinuria type D protein, mitochondrial
9	9606.ENSP00000399805	0.832	Quinone oxidoreductase
10	9606.ENSP00000445920	0.801	Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
11	9606.ENSP00000290349	0.780	Carbonyl reductase [NADPH] 1
12	9606.ENSP00000355890	0.750	Bifunctional glutamate/proline--tRNA ligase
13	9606.ENSP00000330433	0.722	TM2 domain containing 3
14	9606.ENSP00000383840	0.712	Methylmalonic aciduria and homocystinuria type C protein
15	9606.ENSP00000398744	0.708	Adenosine deaminase-like protein
16	9606.ENSP00000285930	0.687	Aldose reductase
17	9606.ENSP00000418770	0.660	Protein/nucleic acid deglycase DJ-1
18	9606.ENSP00000319713	0.655	Type-1 angiotensin II receptor-associated protein
19	9606.ENSP00000268668	0.642	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
20	9606.ENSP00000299821	0.641	Condensin-2 complex subunit H2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016854	1.000	racemase and epimerase activity
GO:0004493	0.939	methylmalonyl-CoA epimerase activity
GO:0043167	0.793	ion binding
GO:0016829	0.557	lyase activity
GO:0043169	0.349	cation binding
GO:0046872	0.340	metal ion binding
GO:0016846	0.326	carbon-sulfur lyase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019752	0.995	carboxylic acid metabolic process
GO:0006637	0.995	acyl-CoA metabolic process
GO:0046395	0.991	carboxylic acid catabolic process
GO:0032787	0.990	monocarboxylic acid metabolic process
GO:0006629	0.986	lipid metabolic process
GO:0044255	0.937	cellular lipid metabolic process
GO:0006631	0.911	fatty acid metabolic process
GO:0016042	0.837	lipid catabolic process
GO:0046459	0.831	short-chain fatty acid metabolic process
GO:0072329	0.766	monocarboxylic acid catabolic process
GO:0044242	0.711	cellular lipid catabolic process
GO:0009062	0.661	fatty acid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0005759	0.938	mitochondrial matrix
GO:0005829	0.497	cytosol
GO:0031981	0.413	nuclear lumen
GO:0005654	0.377	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.1.-.-	1.000	Racemases and epimerases.
RHEA:20553	0.939	(R)-methylmalonyl-CoA = (S)-methylmalonyl-CoA
EC:5.1.99.1	0.939	methylmalonyl-CoA epimerase.
EC:4.-.-.-	0.557	Lyases.
EC:4.4.-.-	0.326	Carbon-sulfur lyases.

[back to server]