StarFunc result for job id Q96PH6

User Input

>input (123 residues)
MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNE
DHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVH
HSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96PH6	1.000	1.000	3.623E-20	123	1.000	1.000	Q96PH6.pdb.gz	DB118_HUMAN Defensin beta 118 OS=Homo sapiens OX=9606 GN=DEFB118 PE=1 SV=1
2	AFDB:Q95LI0	0.433	0.433	6.641E-17	123	0.886	0.886	Q95LI0.pdb.gz	DB118_MACMU Defensin beta 118 OS=Macaca mulatta OX=9544 GN=DEFB118 PE=2 SV=1
3	AFDB:Q7Z7B7	0.270	0.340	1.750E-5	95	0.268	0.347	Q7Z7B7.pdb.gz	DB132_HUMAN Beta-defensin 132 OS=Homo sapiens OX=9606 GN=DEFB132 PE=1 SV=1
4	AFDB:Q5J5C9	0.289	0.458	5.366E-5	76	0.236	0.382	Q5J5C9.pdb.gz	DB121_HUMAN Beta-defensin 121 OS=Homo sapiens OX=9606 GN=DEFB121 PE=1 SV=1
5	AFDB:Q30KQ5	0.321	0.428	9.091E-5	88	0.203	0.284	Q30KQ5.pdb.gz	DB115_HUMAN Beta-defensin 115 OS=Homo sapiens OX=9606 GN=DEFB115 PE=1 SV=1
6	AFDB:Q8NES8	0.301	0.501	1.037E-4	71	0.171	0.296	Q8NES8.pdb.gz	DB124_HUMAN Beta-defensin 124 OS=Homo sapiens OX=9606 GN=DEFB124 PE=1 SV=2
7	AFDB:Q8N690	0.317	0.454	1.645E-4	84	0.203	0.298	Q8N690.pdb.gz	DB119_HUMAN Beta-defensin 119 OS=Homo sapiens OX=9606 GN=DEFB119 PE=2 SV=2
8	AFDB:Q9H1M4	0.361	0.436	7.014E-4	99	0.220	0.273	Q9H1M4.pdb.gz	DB127_HUMAN Beta-defensin 127 OS=Homo sapiens OX=9606 GN=DEFB127 PE=1 SV=1
9	AFDB:Q9H1M3	0.278	0.207	1.188E-3	183	0.203	0.137	Q9H1M3.pdb.gz	DB129_HUMAN Beta-defensin 129 OS=Homo sapiens OX=9606 GN=DEFB129 PE=1 SV=1
10	AFDB:Q8BVC1	0.371	0.278	1.356E-3	179	0.220	0.151	Q8BVC1.pdb.gz	DFB22_MOUSE Beta-defensin 22 OS=Mus musculus OX=10090 GN=Defb22 PE=1 SV=1
11	PDB:2lwlA	0.190	0.496	4.793E-1	45	0.057	0.156	2lwlA.pdb.gz
12	PDB:1bnbA	0.213	0.579	1.376	38	0.065	0.211	1bnbA.pdb.gz
13	PDB:6cs9A	0.226	0.598	1.376	41	0.049	0.146	6cs9A.pdb.gz	Human beta-defensin 2 killsCandida albicansthrough phosphatidylinositol 4,5-bisphosphate-mediated membrane permeabilization.
14	PDB:1e4rA	0.199	0.531	1.791	35	0.065	0.229	1e4rA.pdb.gz
15	PDB:5lcsA	0.212	0.474	2.331	47	0.081	0.213	5lcsA.pdb.gz
16	PDB:7odrO	0.148	0.124	2.490	154	0.065	0.052	7odrO.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
17	PDB:7p5xAJ	0.113	0.138	3.034	89	0.106	0.146	7p5xAJ.pdb.gz	Transcriptional control of mycobacterial DNA damage response by sigma adaptation.
18	PDB:6i31A	0.097	0.193	3.698	54	0.081	0.185	6i31A.pdb.gz
19	PDB:6edtJ	0.154	0.171	5.865	109	0.106	0.119	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
20	PDB:5y58B	0.154	0.048	6.265	568	0.106	0.023	5y58B.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96PH6	1.85e-89	256	123	1.000	1.000	DB118_HUMAN Defensin beta 118 OS=Homo sapiens OX=9606 GN=DEFB118 PE=1 SV=1
2	Q95LI0	8.76e-72	212	123	0.886	0.886	DB118_MACMU Defensin beta 118 OS=Macaca mulatta OX=9544 GN=DEFB118 PE=2 SV=1
3	Q7Z7B7	4.27e-08	49.3	95	0.228	0.295	DB132_HUMAN Beta-defensin 132 OS=Homo sapiens OX=9606 GN=DEFB132 PE=1 SV=1
4	Q7Z7B8	2.64e-05	42.0	93	0.163	0.215	DB128_HUMAN Beta-defensin 128 OS=Homo sapiens OX=9606 GN=DEFB128 PE=1 SV=1
5	Q9BYW3	4.78e-05	42.0	111	0.203	0.225	DB126_HUMAN Beta-defensin 126 OS=Homo sapiens OX=9606 GN=DEFB126 PE=1 SV=2
6	Q9H1M4	1.57e-04	40.0	99	0.179	0.222	DB127_HUMAN Beta-defensin 127 OS=Homo sapiens OX=9606 GN=DEFB127 PE=1 SV=1
7	Q8BVC1	5.87e-04	39.7	179	0.146	0.101	DFB22_MOUSE Beta-defensin 22 OS=Mus musculus OX=10090 GN=Defb22 PE=1 SV=1
8	Q5J5C9	0.001	37.4	76	0.163	0.263	DB121_HUMAN Beta-defensin 121 OS=Homo sapiens OX=9606 GN=DEFB121 PE=1 SV=1
9	Q8NET1	0.002	36.6	73	0.171	0.288	D108B_HUMAN Beta-defensin 108B OS=Homo sapiens OX=9606 GN=DEFB108B PE=1 SV=3
10	Q30KQ5	0.005	35.8	88	0.114	0.159	DB115_HUMAN Beta-defensin 115 OS=Homo sapiens OX=9606 GN=DEFB115 PE=1 SV=1
11	Q6IV18	0.009	35.4	89	0.187	0.258	GLL13_CHICK Gallinacin-13 OS=Gallus gallus OX=9031 GN=GAL13 PE=2 SV=1
12	Q9H1M3	0.040	34.7	183	0.154	0.104	DB129_HUMAN Beta-defensin 129 OS=Homo sapiens OX=9606 GN=DEFB129 PE=1 SV=1
13	Q8K4N2	0.071	32.3	71	0.154	0.268	SG11A_MOUSE Sperm-associated antigen 11A OS=Mus musculus OX=10090 GN=Spag11a PE=3 SV=2
14	Q8N690	0.38	30.8	84	0.130	0.190	DB119_HUMAN Beta-defensin 119 OS=Homo sapiens OX=9606 GN=DEFB119 PE=2 SV=2
15	P59861	0.53	30.0	70	0.130	0.229	D131A_HUMAN Beta-defensin 131A OS=Homo sapiens OX=9606 GN=DEFB131A PE=1 SV=2
16	Q7Z6G8	1.9	30.0	1248	0.146	0.014	ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ANKS1B PE=1 SV=2
17	P0C6S7	2.0	30.0	1260	0.146	0.014	ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus OX=10116 GN=Anks1b PE=1 SV=1
18	Q8BIZ1	2.5	30.0	1259	0.146	0.014	ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus OX=10090 GN=Anks1b PE=1 SV=3
19	P0A8E5	3.2	28.9	120	0.106	0.108	YACL_ECOLI UPF0231 protein YacL OS=Escherichia coli (strain K12) OX=83333 GN=yacL PE=1 SV=1
20	P9WIZ1	5.1	28.5	154	0.203	0.162	NRDR_MYCTU Transcriptional repressor NrdR OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nrdR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13841 Defensin_beta_2	1.7e-05	36.5	Beta defensin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253381

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371835	0.978	Beta-defensin 126
2	9606.ENSP00000312702	0.977	Beta-defensin 114
3	9606.ENSP00000371813	0.971	Beta-defensin 132
4	9606.ENSP00000371825	0.967	Beta-defensin 127
5	9606.ENSP00000383396	0.964	Beta-defensin 116
6	9606.ENSP00000335538	0.956	Beta-defensin 131A
7	9606.ENSP00000371643	0.956	Beta-defensin 135
8	9606.ENSP00000246105	0.950	Beta-defensin 129
9	9606.ENSP00000326309	0.945	Beta-defensin 124
10	9606.ENSP00000365492	0.944	Defensin beta 119
11	9606.ENSP00000371847	0.942	Beta-defensin 125
12	9606.ENSP00000297439	0.941	Beta-defensin 1
13	9606.ENSP00000328359	0.923	Neutrophil defensin 3
14	9606.ENSP00000417128	0.919	Beta-defensin 121
15	9606.ENSP00000335382	0.917	Beta-defensin 128
16	9606.ENSP00000365486	0.912	Beta-defensin 123
17	9606.ENSP00000360190	0.911	Beta-defensin 110
18	9606.ENSP00000381703	0.908	Beta-defensin 113
19	9606.ENSP00000383398	0.903	Beta-defensin 115
20	9606.ENSP00000319126	0.902	Beta-defensin 112

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001530	1.000	lipopolysaccharide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006955	0.995	immune response
GO:0098542	0.995	defense response to other organism
GO:0009617	0.990	response to bacterium
GO:0042742	0.981	defense response to bacterium
GO:0045087	0.933	innate immune response
GO:0009987	0.912	cellular process
GO:0050829	0.895	defense response to Gram-negative bacterium
GO:0006959	0.819	humoral immune response
GO:0061844	0.798	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0050789	0.797	regulation of biological process
GO:0031640	0.787	killing of cells of another organism
GO:0050830	0.716	defense response to Gram-positive bacterium
GO:0050794	0.654	regulation of cellular process
GO:0048583	0.548	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.953	extracellular space
GO:0005622	0.545	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]