StarFunc result for job id Q96PJ5

User Input

>input (515 residues)
MLLWASLLAFAPVCGQSAAAHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEKTTWYHR
HYWGEKLTLTPGNTLEVRESGLYRCQARGSPRSNPVRLLFSSDSLILQAPYSVFEGDTLV
LRCHRRRKEKLTAVKYTWNGNILSISNKSWDLLIPQASSNNNGNYRCIGYGDENDVFRSN
FKIIKIQELFPHPELKATDSQPTEGNSVNLSCETQLPPERSDTPLHFNFFRDGEVILSDW
STYPELQLPTVWRENSGSYWCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQA
VEGEMLVLVCSVAEGTGDTTFSWHREDMQESLGRKTQRSLRAELELPAIRQSHAGGYYCT
ADNSYGPVQSMVLNVTVRETPGNRDGLVAAGATGGLLSALLLAVALLFHCWRRRKSGVGF
LGDETRLPPAPGPGESSHSICPAQVELQSLYVDVHPKKGDLVYSEIQTTQLGEEEEANTS
RTLLEDKDVSVVYSEVKTQHPDNSAGKISSKDEES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96PJ5	1.000	1.000	1.630E-87	515	1.000	1.000	Q96PJ5.pdb.gz	FCRL4_HUMAN Fc receptor-like protein 4 OS=Homo sapiens OX=9606 GN=FCRL4 PE=1 SV=1
2	AFDB:Q96P31	0.623	0.446	2.365E-41	734	0.429	0.301	Q96P31.pdb.gz	FCRL3_HUMAN Fc receptor-like protein 3 OS=Homo sapiens OX=9606 GN=FCRL3 PE=1 SV=1
3	AFDB:Q68SN8	0.495	0.431	1.301E-39	596	0.334	0.289	Q68SN8.pdb.gz	FCRL5_MOUSE Fc receptor-like protein 5 OS=Mus musculus OX=10090 GN=Fcrl5 PE=1 SV=3
4	AFDB:Q96RD9	0.523	0.288	2.388E-38	977	0.336	0.177	Q96RD9.pdb.gz	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
5	AFDB:Q6DN72	0.369	0.433	9.120E-27	434	0.239	0.283	Q6DN72.pdb.gz	FCRL6_HUMAN Fc receptor-like protein 6 OS=Homo sapiens OX=9606 GN=FCRL6 PE=1 SV=2
6	AFDB:Q6BAA4	0.442	0.523	3.265E-25	426	0.243	0.293	Q6BAA4.pdb.gz	FCRLB_HUMAN Fc receptor-like B OS=Homo sapiens OX=9606 GN=FCRLB PE=1 SV=1
7	AFDB:Q08481	0.236	0.176	4.145E-25	727	0.231	0.164	Q08481.pdb.gz	PECA1_MOUSE Platelet endothelial cell adhesion molecule OS=Mus musculus OX=10090 GN=Pecam1 PE=1 SV=1
8	AFDB:Q3SWT0	0.240	0.191	8.780E-24	678	0.216	0.164	Q3SWT0.pdb.gz	PECA1_RAT Platelet endothelial cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Pecam1 PE=1 SV=1
9	AFDB:P26151	0.396	0.488	9.659E-24	404	0.227	0.290	P26151.pdb.gz	FCGR1_MOUSE High affinity immunoglobulin gamma Fc receptor I OS=Mus musculus OX=10090 GN=Fcgr1 PE=1 SV=1
10	AFDB:Q5DRQ8	0.430	0.507	1.115E-23	427	0.245	0.295	Q5DRQ8.pdb.gz	FCRLB_MOUSE Fc receptor-like B OS=Mus musculus OX=10090 GN=Fcrlb PE=2 SV=2
11	PDB:5oj2B	0.184	0.148	3.025E-12	692	0.155	0.116	5oj2B.pdb.gz
12	PDB:1e07A	0.227	0.195	5.899E-12	642	0.132	0.106	1e07A.pdb.gz
13	PDB:6h03A	0.218	0.120	1.566E-9	1223	0.085	0.036	6h03A.pdb.gz
14	PDB:7u05A	0.162	0.093	3.697E-9	1114	0.097	0.045	7u05A.pdb.gz
15	PDB:4lnvB	0.145	0.082	4.067E-9	1063	0.078	0.038	4lnvB.pdb.gz
16	PDB:7q1yA	0.234	0.115	9.599E-9	1374	0.074	0.028	7q1yA.pdb.gz
17	PDB:4lnvA	0.151	0.071	2.160E-8	1276	0.111	0.045	4lnvA.pdb.gz
18	PDB:6dldD	0.226	0.362	2.266E-8	269	0.103	0.197	6dldD.pdb.gz
19	PDB:7q5zA	0.160	0.081	3.318E-8	1344	0.078	0.030	7q5zA.pdb.gz
20	PDB:6dlfA	0.217	0.389	1.043E-7	236	0.087	0.191	6dlfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96PJ5	0.0	1069	515	1.000	1.000	FCRL4_HUMAN Fc receptor-like protein 4 OS=Homo sapiens OX=9606 GN=FCRL4 PE=1 SV=1
2	Q96RD9	4.46e-100	325	977	0.344	0.181	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
3	Q96P31	3.01e-96	309	734	0.320	0.225	FCRL3_HUMAN Fc receptor-like protein 3 OS=Homo sapiens OX=9606 GN=FCRL3 PE=1 SV=1
4	Q96LA5	1.03e-88	283	508	0.295	0.299	FCRL2_HUMAN Fc receptor-like protein 2 OS=Homo sapiens OX=9606 GN=FCRL2 PE=1 SV=1
5	Q68SN8	7.18e-81	265	596	0.303	0.262	FCRL5_MOUSE Fc receptor-like protein 5 OS=Mus musculus OX=10090 GN=Fcrl5 PE=1 SV=3
6	Q5DRQ8	5.93e-52	184	427	0.235	0.283	FCRLB_MOUSE Fc receptor-like B OS=Mus musculus OX=10090 GN=Fcrlb PE=2 SV=2
7	Q96LA6	7.98e-51	181	429	0.179	0.214	FCRL1_HUMAN Fc receptor-like protein 1 OS=Homo sapiens OX=9606 GN=FCRL1 PE=1 SV=1
8	Q6BAA4	1.76e-48	175	426	0.204	0.246	FCRLB_HUMAN Fc receptor-like B OS=Homo sapiens OX=9606 GN=FCRLB PE=1 SV=1
9	P12314	1.02e-41	155	374	0.204	0.281	FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens OX=9606 GN=FCGR1A PE=1 SV=2
10	Q6DN72	1.38e-41	156	434	0.254	0.302	FCRL6_HUMAN Fc receptor-like protein 6 OS=Homo sapiens OX=9606 GN=FCRL6 PE=1 SV=2
11	P26151	1.07e-35	139	404	0.188	0.240	FCGR1_MOUSE High affinity immunoglobulin gamma Fc receptor I OS=Mus musculus OX=10090 GN=Fcgr1 PE=1 SV=1
12	A0A0B4J2J0	2.81e-35	137	353	0.184	0.269	A0A0B4J2J0_RAT Fc fragment of IgG receptor Ia OS=Rattus norvegicus OX=10116 GN=Fcgr1a PE=4 SV=1
13	Q7L513	7.19e-32	127	359	0.159	0.228	FCRLA_HUMAN Fc receptor-like A OS=Homo sapiens OX=9606 GN=FCRLA PE=1 SV=2
14	Q920A9	8.41e-30	122	352	0.161	0.236	FCRLA_MOUSE Fc receptor-like A OS=Mus musculus OX=10090 GN=Fcrla PE=1 SV=1
15	P31994	1.85e-24	105	310	0.120	0.200	FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-b OS=Homo sapiens OX=9606 GN=FCGR2B PE=1 SV=2
16	P12319	2.36e-24	104	257	0.130	0.261	FCERA_HUMAN High affinity immunoglobulin epsilon receptor subunit alpha OS=Homo sapiens OX=9606 GN=FCER1A PE=1 SV=1
17	P31995	3.13e-24	105	323	0.120	0.192	FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c OS=Homo sapiens OX=9606 GN=FCGR2C PE=1 SV=1
18	P27645	1.67e-21	96.3	267	0.120	0.232	FCGR3_RAT Low affinity immunoglobulin gamma Fc region receptor III OS=Rattus norvegicus OX=10116 GN=Fcgr3 PE=2 SV=1
19	P08101	9.33e-21	95.5	330	0.117	0.182	FCGR2_MOUSE Low affinity immunoglobulin gamma Fc region receptor II OS=Mus musculus OX=10090 GN=Fcgr2 PE=1 SV=2
20	Q63203	1.10e-20	94.4	285	0.118	0.214	FCGR2_RAT Low affinity immunoglobulin gamma Fc region receptor II OS=Rattus norvegicus OX=10116 GN=Fcgr2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	9.2e-08	43.4	Immunoglobulin I-set domain
2	PF00047 ig	3.3e-18	77.0	Immunoglobulin domain
3	PF13895 Ig_2	2.9e-27	106.1	Immunoglobulin domain
4	PF13927 Ig_3	2.5e-26	103.3	Immunoglobulin domain
5	PF16680 Ig_4	2.1e-06	39.5	T-cell surface glycoprotein CD3 delta chain
6	PF16681 Ig_5	0.00012	33.7	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
7	PF17736 Ig_C17orf99	5.3e+02	12.1	C17orf99 Ig domain
8	PF16706 Izumo-Ig	0.022	26.0	Izumo-like Immunoglobulin domain
9	PF07686 V-set	5.2e-06	38.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000271532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348888	0.764	Polymeric immunoglobulin receptor
2	9606.ENSP00000234739	0.721	B-cell CLL/lymphoma 9 protein
3	9606.ENSP00000340944	0.683	Tyrosine-protein phosphatase non-receptor type 11
4	9606.ENSP00000369055	0.672	Beta-1,4-galactosyltransferase 1
5	9606.ENSP00000356024	0.670	Complement receptor type 2
6	9606.ENSP00000266557	0.654	CD27 antigen
7	9606.ENSP00000304364	0.642	C1GALT1-specific chaperone 1
8	9606.ENSP00000389176	0.630	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
9	9606.ENSP00000437940	0.562	B-lymphocyte antigen CD19
10	9606.ENSP00000401502	0.529	Sialic acid-binding Ig-like lectin 6
11	9606.ENSP00000375622	0.510	Leukocyte-associated immunoglobulin-like receptor 1
12	9606.ENSP00000226279	0.508	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
13	9606.ENSP00000379980	0.507	B-cell differentiation antigen CD72

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.350	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0050896	0.988	response to stimulus
GO:0048518	0.889	positive regulation of biological process
GO:0002682	0.888	regulation of immune system process
GO:0032501	0.868	multicellular organismal process
GO:0050776	0.866	regulation of immune response
GO:0048522	0.772	positive regulation of cellular process
GO:0051239	0.759	regulation of multicellular organismal process
GO:0048519	0.755	negative regulation of biological process
GO:0023052	0.754	signaling
GO:0007154	0.748	cell communication
GO:0051716	0.716	cellular response to stimulus
GO:0002376	0.706	immune system process
GO:0019222	0.688	regulation of metabolic process
GO:0060255	0.626	regulation of macromolecule metabolic process
GO:0009966	0.596	regulation of signal transduction
GO:0050865	0.574	regulation of cell activation
GO:0032879	0.550	regulation of localization
GO:0007165	0.543	signal transduction
GO:0002684	0.538	positive regulation of immune system process
GO:0080090	0.512	regulation of primary metabolic process
GO:0009893	0.512	positive regulation of metabolic process
GO:0031323	0.511	regulation of cellular metabolic process
GO:0002683	0.510	negative regulation of immune system process
GO:0002694	0.507	regulation of leukocyte activation
GO:0002697	0.505	regulation of immune effector process
GO:0051171	0.501	regulation of nitrogen compound metabolic process
GO:0048523	0.462	negative regulation of cellular process
GO:0007166	0.452	cell surface receptor signaling pathway
GO:0051240	0.449	positive regulation of multicellular organismal process
GO:0010604	0.435	positive regulation of macromolecule metabolic process
GO:0048856	0.430	anatomical structure development
GO:0050854	0.415	regulation of antigen receptor-mediated signaling pathway
GO:0010468	0.388	regulation of gene expression
GO:0051249	0.379	regulation of lymphocyte activation
GO:0048584	0.345	positive regulation of response to stimulus
GO:0001775	0.325	cell activation
GO:0002696	0.324	positive regulation of leukocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	0.997	cell surface
GO:0005886	0.966	plasma membrane
GO:0043231	0.318	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]