StarFunc result for job id Q96PK6

User Input

>input (669 residues)
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHEL
RPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHME
KEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGG
FSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQ
PSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAAS
SLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRA
AASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQ
QAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASM
GLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASY
RGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSK
RYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQ
MHSGYQRRM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z4Z0	0.261	0.261	4.376E-82	669	1.000	1.000	A0A0S2Z4Z0.pdb.gz	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
2	PDB:5lsbA	0.112	0.390	8.687E-12	176	0.063	0.239	5lsbA.pdb.gz
3	PDB:7oqcF	0.111	0.267	6.485E-11	267	0.067	0.169	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
4	PDB:6y53o	0.124	0.410	1.467E-8	160	0.054	0.225	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
5	AFDB:Q14966	0.139	0.060	2.098E-8	1978	0.136	0.046	Q14966.pdb.gz	ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2
6	PDB:5vsuA	0.124	0.188	3.659E-8	387	0.040	0.070	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
7	PDB:7evoD	0.101	0.327	4.669E-8	200	0.046	0.155	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
8	AFDB:E9PYH6	0.111	0.048	6.280E-8	1716	0.181	0.071	E9PYH6.pdb.gz	SET1A_MOUSE Histone-lysine N-methyltransferase SETD1A OS=Mus musculus OX=10090 GN=Setd1a PE=1 SV=1
9	PDB:6y5qq	0.101	0.358	7.152E-8	178	0.043	0.163	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
10	PDB:6ff7X	0.102	0.384	1.783E-7	171	0.052	0.205	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
11	AFDB:Q5LJZ2	0.104	0.044	2.880E-7	1641	0.157	0.064	Q5LJZ2.pdb.gz	SET1_DROME Histone-lysine N-methyltransferase SETD1 OS=Drosophila melanogaster OX=7227 GN=Set1 PE=1 SV=1
12	PDB:6r5kH	0.104	0.175	5.339E-7	394	0.063	0.107	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
13	AFDB:F4J5A7	0.111	0.077	2.581E-6	987	0.157	0.106	F4J5A7.pdb.gz	F4J5A7_ARATH RNA recognition motif (RRM)-containing protein OS=Arabidopsis thaliana OX=3702 GN=At3g23900 PE=1 SV=1
14	AFDB:Q8C7E9	0.133	0.140	5.045E-6	632	0.152	0.161	Q8C7E9.pdb.gz	CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus OX=10090 GN=Cstf2t PE=1 SV=2
15	PDB:5xjcw	0.106	0.751	6.489E-6	91	0.031	0.231	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
16	AFDB:A8DYK5	0.098	0.051	9.859E-6	1306	0.166	0.085	A8DYK5.pdb.gz	A8DYK5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Isha PE=1 SV=1
17	PDB:3lqvB	0.104	0.583	1.123E-5	115	0.028	0.165	3lqvB.pdb.gz	Branch Recognition by SF3b14
18	AFDB:Q8CFT2	0.108	0.038	2.313E-5	1985	0.157	0.053	Q8CFT2.pdb.gz	SET1B_MOUSE Histone-lysine N-methyltransferase SETD1B OS=Mus musculus OX=10090 GN=Setd1b PE=1 SV=2
19	AFDB:Q1LY77	0.106	0.040	3.137E-5	1844	0.138	0.050	Q1LY77.pdb.gz	SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio OX=7955 GN=setd1ba PE=1 SV=2
20	AFDB:Q9UPN6	0.100	0.060	3.543E-5	1271	0.178	0.094	Q9UPN6.pdb.gz	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4Z0	0.0	1308	669	1.000	1.000	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
2	Q8C2Q3	0.0	1292	669	0.984	0.984	RBM14_MOUSE RNA-binding protein 14 OS=Mus musculus OX=10090 GN=Rbm14 PE=1 SV=1
3	Q96PK6	0.0	1308	669	1.000	1.000	RBM14_HUMAN RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2
4	A0A0R4IJ04	1.28e-45	172	556	0.120	0.144	A0A0R4IJ04_DANRE RNA binding motif protein 14 isoform X3 OS=Danio rerio OX=7955 GN=rbm14 PE=1 SV=2
5	Q6NV05	1.36e-45	172	556	0.120	0.144	Q6NV05_DANRE RNA binding motif protein 14 OS=Danio rerio OX=7955 GN=zgc:85696 PE=1 SV=1
6	F1Q7F8	7.74e-41	155	384	0.111	0.193	F1Q7F8_DANRE RNA binding motif protein 4 like isoform X1 OS=Danio rerio OX=7955 GN=Rbm4 PE=1 SV=1
7	Q803F7	7.76e-41	155	385	0.111	0.192	Q803F7_DANRE RNA binding motif protein 4 like OS=Danio rerio OX=7955 GN=rbm4l PE=1 SV=1
8	Q8C7Q4	1.46e-40	154	361	0.109	0.202	RBM4_MOUSE RNA-binding protein 4 OS=Mus musculus OX=10090 GN=Rbm4 PE=1 SV=1
9	Q9BWF3	1.64e-40	154	364	0.108	0.198	RBM4_HUMAN RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4 PE=1 SV=1
10	Q9BQ04	2.60e-40	153	359	0.109	0.203	RBM4B_HUMAN RNA-binding protein 4B OS=Homo sapiens OX=9606 GN=RBM4B PE=1 SV=1
11	Q8VE92	3.15e-40	153	357	0.109	0.204	RBM4B_MOUSE RNA-binding protein 4B OS=Mus musculus OX=10090 GN=Rbm4b PE=1 SV=1
12	Q503D7	1.96e-37	147	471	0.112	0.159	Q503D7_DANRE RNA binding motif protein 14 OS=Danio rerio OX=7955 GN=zgc:110682 PE=1 SV=1
13	Q94901	1.15e-31	128	352	0.097	0.185	LARK_DROME RNA-binding protein lark OS=Drosophila melanogaster OX=7227 GN=lark PE=1 SV=1
14	Q10667	2.44e-14	76.6	305	0.048	0.105	RNP1_CAEEL RNA-binding protein rnp-1 OS=Caenorhabditis elegans OX=6239 GN=rnp-1 PE=2 SV=1
15	P48809	5.94e-13	73.6	421	0.063	0.100	RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster OX=7227 GN=Hrb27C PE=1 SV=2
16	O94432	1.00e-12	73.2	474	0.070	0.099	YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC660.15 PE=4 SV=1
17	Q9JII5	1.16e-12	72.8	406	0.072	0.118	DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus OX=10090 GN=Dazap1 PE=1 SV=2
18	K7EK33	1.21e-12	72.4	406	0.072	0.118	K7EK33_HUMAN DAZ associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1 PE=1 SV=2
19	K7EQ55	1.57e-12	72.0	406	0.072	0.118	K7EQ55_HUMAN DAZ associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1 PE=1 SV=2
20	A0A0S2Z569	1.62e-12	72.0	407	0.072	0.118	A0A0S2Z569_HUMAN DAZ associated protein 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=DAZAP1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03880 DbpA	10	17.5	DbpA RNA binding domain
2	PF00076 RRM_1	1.8e-25	99.9	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF13893 RRM_5	0.0013	29.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16842 RRM_occluded	6.7	18.0	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010634148.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010631133.1	0.877	Heterogeneous nuclear ribonucleoprotein L isoform X1
2	885580.XP_010612090.1	0.874	Matrin-3
3	885580.XP_010633268.1	0.869	Polypyrimidine tract-binding protein 1
4	885580.XP_010603981.1	0.866	Heterogeneous nuclear ribonucleoprotein M
5	885580.XP_010612457.1	0.862	Heterogeneous nuclear ribonucleoprotein A0
6	885580.XP_010626562.1	0.860	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
7	885580.XP_010618541.1	0.858	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
8	885580.XP_010624289.1	0.855	Heterogeneous nuclear ribonucleoprotein R
9	885580.XP_010636133.1	0.847	Heterogeneous nuclear ribonucleoproteins C1/C2 isoform X1
10	885580.XP_010622511.1	0.844	Transformer-2 protein homolog beta
11	885580.XP_010608141.1	0.838	Spliceosome RNA helicase DDX39B
12	885580.XP_010637127.1	0.829	Serine/arginine-rich splicing factor 3
13	885580.XP_010603940.1	0.828	Belongs to the RRM elav family.
14	885580.XP_010612902.1	0.826	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome.
15	885580.XP_010643665.1	0.826	Enhancer of rudimentary like protein
16	885580.XP_010616942.1	0.825	THO complex subunit 4
17	885580.XP_010626413.1	0.825	TAR DNA-binding protein 43 isoform X1
18	885580.XP_010632117.1	0.805	Paraspeckle component 1
19	885580.XP_010643325.1	0.798	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing. May indirectly play a role in hair development.
20	885580.XP_010631224.1	0.797	Heterogeneous nuclear ribonucleoprotein K

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003713	0.997	transcription coactivator activity
GO:0030374	0.990	nuclear receptor coactivator activity
GO:0003729	0.901	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0016043	0.986	cellular component organization
GO:0044085	0.937	cellular component biogenesis
GO:0022607	0.933	cellular component assembly
GO:0007017	0.907	microtubule-based process
GO:0070925	0.906	organelle assembly
GO:0098534	0.849	centriole assembly
GO:0019222	0.844	regulation of metabolic process
GO:0060255	0.823	regulation of macromolecule metabolic process
GO:0050896	0.720	response to stimulus
GO:0071704	0.680	organic substance metabolic process
GO:0044238	0.645	primary metabolic process
GO:0006807	0.618	nitrogen compound metabolic process
GO:0051171	0.615	regulation of nitrogen compound metabolic process
GO:0080090	0.596	regulation of primary metabolic process
GO:0043170	0.590	macromolecule metabolic process
GO:0031323	0.582	regulation of cellular metabolic process
GO:0010468	0.574	regulation of gene expression
GO:0019219	0.507	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.494	positive regulation of biological process
GO:0051252	0.429	regulation of RNA metabolic process
GO:0048522	0.369	positive regulation of cellular process
GO:0044237	0.345	cellular metabolic process
GO:0010556	0.320	regulation of macromolecule biosynthetic process
GO:0048519	0.319	negative regulation of biological process
GO:0031326	0.319	regulation of cellular biosynthetic process
GO:0009893	0.317	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	0.999	nuclear body
GO:0032991	0.989	protein-containing complex
GO:0016607	0.985	nuclear speck
GO:0005737	0.968	cytoplasm
GO:1990904	0.846	ribonucleoprotein complex
GO:0005829	0.373	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]