StarFunc result for job id Q96PM9

User Input

>input (386 residues)
MILGSLSRAGPLPLLRQPPIMQPPLDLKQILPFPLEPAPTLGLFSNYSTMDPVQKAVLSH
TFGGPLLKTKRPVISCNICQIRFNSQSQAEAHYKGNRHARRVKGIEAAKTRGREPGVREP
GDPAPPGSTPTNGDGVAPRPVSMENGLGPAPGSPEKQPGSPSPPSIPETGQGVTKGEGGT
PAPASLPGGSKEEEEKAKRLLYCALCKVAVNSLSQLEAHNKGTKHKTILEARSGLGPIKA
YPRLGPPTPGEPEAPAQDRTFHCEICNVKVNSEVQLKQHISSRRHRDGVAGKPNPLLSRH
KKSRGAGELAGTLTFSKELPKSLAGGLLPSPLAVAAVMAAAAGSPLSLRPAPAAPLLQGP
PITHPLLHPAPGPIRTAHGPILFSPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VD12	0.525	0.525	8.703E-59	386	0.964	0.964	Q8VD12.pdb.gz	Z385A_MOUSE Zinc finger protein 385A OS=Mus musculus OX=10090 GN=Znf385a PE=1 SV=2
2	AFDB:Q9H6B1	0.223	0.221	1.402E-32	395	0.508	0.496	Q9H6B1.pdb.gz	Z385D_HUMAN Zinc finger protein 385D OS=Homo sapiens OX=9606 GN=ZNF385D PE=2 SV=1
3	AFDB:Q569K4	0.254	0.216	4.925E-30	471	0.490	0.401	Q569K4.pdb.gz	Z385B_HUMAN Zinc finger protein 385B OS=Homo sapiens OX=9606 GN=ZNF385B PE=1 SV=1
4	AFDB:A0A024R885	0.098	0.046	5.124E-3	898	0.155	0.067	A0A024R885.pdb.gz
5	AFDB:Q8VEH2	0.097	0.049	2.534E-2	845	0.166	0.076	Q8VEH2.pdb.gz	Q8VEH2_MOUSE CDKN1A interacting zinc finger protein 1 OS=Mus musculus OX=10090 GN=Ciz1 PE=1 SV=1
6	AFDB:Q5SYW2	0.095	0.045	3.779E-2	870	0.150	0.067	Q5SYW2.pdb.gz	Q5SYW2_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
7	AFDB:Q01981	0.084	0.081	4.039E-2	416	0.184	0.171	Q01981.pdb.gz	CREA_EMENI DNA-binding protein creA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=creA PE=1 SV=1
8	AFDB:J9WUP1	0.073	0.049	4.317E-2	641	0.168	0.101	J9WUP1.pdb.gz	J9WUP1_PENDI PacC OS=Penicillium digitatum OX=36651 PE=2 SV=1
9	AFDB:Q8N1G0	0.093	0.036	4.317E-2	1237	0.161	0.050	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
10	AFDB:Q9WTL3	0.066	0.031	8.983E-2	960	0.176	0.071	Q9WTL3.pdb.gz	SEM6C_RAT Semaphorin-6C OS=Rattus norvegicus OX=10116 GN=Sema6c PE=2 SV=1
11	PDB:6qx91C	0.078	0.531	1.766E-1	50	0.026	0.200	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:5zwmv	0.094	0.202	4.486E-1	174	0.034	0.075	5zwmv.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
13	PDB:3mhhC	0.078	0.233	5.478E-1	93	0.034	0.140	3mhhC.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
14	PDB:5z56v	0.095	0.205	5.478E-1	167	0.049	0.114	5z56v.pdb.gz	Structure of the human activated spliceosome in three conformational states.
15	PDB:7pt6I	0.063	0.071	5.478E-1	341	0.047	0.053	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
16	PDB:7v3vI	0.067	0.077	6.259E-1	328	0.041	0.049	7v3vI.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
17	PDB:6gejS	0.078	0.121	7.151E-1	208	0.044	0.082	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
18	PDB:7p5zG	0.068	0.117	7.151E-1	213	0.039	0.070	7p5zG.pdb.gz	Structural mechanism for the selective phosphorylation of DNA-loaded MCM double hexamers by the Dbf4-dependent kinase.
19	PDB:6ff79	0.085	0.076	8.170E-1	432	0.052	0.046	6ff79.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:5gm6I	0.087	0.298	8.732E-1	102	0.049	0.186	5gm6I.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8VD12	0.0	735	386	0.964	0.964	Z385A_MOUSE Zinc finger protein 385A OS=Mus musculus OX=10090 GN=Znf385a PE=1 SV=2
2	Q96PM9	0.0	760	386	1.000	1.000	Z385A_HUMAN Zinc finger protein 385A OS=Homo sapiens OX=9606 GN=ZNF385A PE=1 SV=2
3	Q9H6B1	3.18e-105	317	395	0.505	0.494	Z385D_HUMAN Zinc finger protein 385D OS=Homo sapiens OX=9606 GN=ZNF385D PE=2 SV=1
4	Q569K4	4.60e-94	291	471	0.482	0.395	Z385B_HUMAN Zinc finger protein 385B OS=Homo sapiens OX=9606 GN=ZNF385B PE=1 SV=1
5	Q66K41	3.79e-71	230	422	0.453	0.415	Z385C_HUMAN Zinc finger protein 385C OS=Homo sapiens OX=9606 GN=ZNF385C PE=1 SV=4
6	E9QJ33	6.33e-67	221	459	0.415	0.349	E9QJ33_DANRE Zinc finger protein 385C OS=Danio rerio OX=7955 GN=znf385c PE=4 SV=2
7	Q8AVN9	2.97e-10	63.9	524	0.130	0.095	ZN346_XENLA Zinc finger protein 346 OS=Xenopus laevis OX=8355 GN=znf346 PE=1 SV=1
8	O54836	2.74e-06	50.8	290	0.145	0.193	ZMAT3_MOUSE Zinc finger matrin-type protein 3 OS=Mus musculus OX=10090 GN=Zmat3 PE=2 SV=1
9	Q9HA38	6.55e-06	49.7	289	0.145	0.194	ZMAT3_HUMAN Zinc finger matrin-type protein 3 OS=Homo sapiens OX=9606 GN=ZMAT3 PE=1 SV=1
10	A0A494C120	2.31e-05	48.5	383	0.140	0.141	A0A494C120_HUMAN Zinc finger matrin-type 3 OS=Homo sapiens OX=9606 GN=ZMAT3 PE=1 SV=1
11	Q9H898	2.04e-04	44.7	229	0.124	0.210	ZMAT4_HUMAN Zinc finger matrin-type protein 4 OS=Homo sapiens OX=9606 GN=ZMAT4 PE=1 SV=1
12	Q9C0A1	3.11e-04	45.4	2572	0.098	0.015	ZFHX2_HUMAN Zinc finger homeobox protein 2 OS=Homo sapiens OX=9606 GN=ZFHX2 PE=1 SV=3
13	F4K209	7.11e-04	44.3	995	0.073	0.028	F4K209_ARATH Endonuclease or glycosyl hydrolase with C2H2-type zinc finger domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=MAF19.19 PE=1 SV=1
14	Q15911	0.001	43.5	3703	0.060	0.006	ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens OX=9606 GN=ZFHX3 PE=1 SV=2
15	Q61329	0.001	43.5	3726	0.060	0.006	ZFHX3_MOUSE Zinc finger homeobox protein 3 OS=Mus musculus OX=10090 GN=Zfhx3 PE=1 SV=1
16	Q9R0B7	0.001	42.7	294	0.124	0.163	ZN346_MOUSE Zinc finger protein 346 OS=Mus musculus OX=10090 GN=Znf346 PE=1 SV=1
17	C9J8H5	0.002	40.8	148	0.044	0.115	C9J8H5_HUMAN Zinc finger matrin-type 3 (Fragment) OS=Homo sapiens OX=9606 GN=ZMAT3 PE=1 SV=1
18	D6RJ07	0.002	42.4	310	0.124	0.155	D6RJ07_HUMAN Zinc finger protein 346 OS=Homo sapiens OX=9606 GN=ZNF346 PE=1 SV=1
19	F1M4Q6	0.002	43.1	3730	0.060	0.006	F1M4Q6_RAT Zinc finger homeobox 3 OS=Rattus norvegicus OX=10116 GN=Zfhx3 PE=4 SV=3
20	O59811	0.003	42.0	463	0.070	0.058	REI1_SCHPO Cytoplasmic 60S subunit biogenesis factor SPCC550.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.15c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17003 Actin_micro	2.9e+02	12.0	Putative actin-like family
2	PF11931 SF3a60_Prp9_C	26	16.7	SF3a60/Prp9 C-terminal
3	PF19088 TUTase	1.3	19.9	TUTase nucleotidyltransferase domain
4	PF00096 zf-C2H2	0.45	22.2	Zinc finger, C2H2 type
5	PF12756 zf-C2H2_2	0.00021	32.9	C2H2 type zinc-finger (2 copies)
6	PF13894 zf-C2H2_4	4.4	19.4	C2H2-type zinc finger
7	PF16293 zf-C2H2_9	34	15.7	C2H2 type zinc-finger (1 copy)
8	PF12171 zf-C2H2_jaz	2.2e-12	58.2	Zinc-finger double-stranded RNA-binding
9	PF16278 zf-C2HE	4.3e+02	12.8	C2HE / C2H2 / C2HC zinc-binding finger
10	PF07535 zf-DBF	1.6	20.2	DBF zinc finger
11	PF12874 zf-met	1.2e-20	84.4	Zinc-finger of C2H2 type
12	PF06220 zf-U1	0.16	23.1	U1 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338927

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340989	0.902	14-3-3 protein sigma
2	9606.ENSP00000269305	0.858	Cellular tumor antigen p53
3	9606.ENSP00000262455	0.764	Endoplasmic reticulum resident protein 44
4	9606.ENSP00000227520	0.751	Coiled-coil domain containing 86
5	9606.ENSP00000314407	0.739	Carbonic anhydrase-related protein
6	9606.ENSP00000306253	0.720	Inositol 1,4,5-trisphosphate receptor type 1
7	9606.ENSP00000417196	0.711	Poly(rC)-binding protein 4
8	9606.ENSP00000264689	0.709	Ufm1-specific protease 2
9	9606.ENSP00000400806	0.674	Aprataxin
10	9606.ENSP00000288466	0.670	Zinc finger protein 618
11	9606.ENSP00000381250	0.624	Apolipoprotein F
12	9606.ENSP00000296424	0.621	3-hydroxybutyrate dehydrogenase type 2
13	9606.ENSP00000329795	0.602	Transmembrane protein 105
14	9606.ENSP00000426167	0.599	Oligosaccharyltransferase complex subunit OSTC
15	9606.ENSP00000364742	0.593	F-box only protein 42
16	9606.ENSP00000388550	0.593	RING finger protein 24
17	9606.ENSP00000354040	0.587	Nucleolar GTP-binding protein 1
18	9606.ENSP00000379904	0.571	Thyroid hormone receptor beta
19	9606.ENSP00000247182	0.563	Homeobox protein SIX1
20	9606.ENSP00000483154	0.541	Protein FAM71D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.996	protein binding
GO:0003730	0.929	mRNA 3'-UTR binding
GO:0002039	0.753	p53 binding
GO:0003677	0.530	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0048518	0.968	positive regulation of biological process
GO:0009966	0.965	regulation of signal transduction
GO:0048522	0.964	positive regulation of cellular process
GO:0009987	0.953	cellular process
GO:0048523	0.930	negative regulation of cellular process
GO:1902531	0.914	regulation of intracellular signal transduction
GO:0080134	0.902	regulation of response to stress
GO:0060548	0.890	negative regulation of cell death
GO:1901796	0.890	regulation of signal transduction by p53 class mediator
GO:2001233	0.888	regulation of apoptotic signaling pathway
GO:2001020	0.885	regulation of response to DNA damage stimulus
GO:2001242	0.878	regulation of intrinsic apoptotic signaling pathway
GO:0048584	0.856	positive regulation of response to stimulus
GO:0019222	0.844	regulation of metabolic process
GO:2001021	0.840	negative regulation of response to DNA damage stimulus
GO:0051171	0.827	regulation of nitrogen compound metabolic process
GO:0060255	0.806	regulation of macromolecule metabolic process
GO:0080090	0.798	regulation of primary metabolic process
GO:0031323	0.796	regulation of cellular metabolic process
GO:0043066	0.766	negative regulation of apoptotic process
GO:1902229	0.763	regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:1902532	0.749	negative regulation of intracellular signal transduction
GO:1901797	0.706	negative regulation of signal transduction by p53 class mediator
GO:0050896	0.689	response to stimulus
GO:0010468	0.663	regulation of gene expression
GO:2001234	0.650	negative regulation of apoptotic signaling pathway
GO:0051716	0.642	cellular response to stimulus
GO:0010556	0.562	regulation of macromolecule biosynthetic process
GO:0031326	0.561	regulation of cellular biosynthetic process
GO:0009967	0.421	positive regulation of signal transduction
GO:2001022	0.411	positive regulation of response to DNA damage stimulus
GO:1902533	0.373	positive regulation of intracellular signal transduction
GO:1902253	0.339	regulation of intrinsic apoptotic signaling pathway by p53 class mediator
GO:0043516	0.331	regulation of DNA damage response, signal transduction by p53 class mediator
GO:2001243	0.323	negative regulation of intrinsic apoptotic signaling pathway
GO:0008219	0.316	cell death
GO:0009893	0.311	positive regulation of metabolic process
GO:0019219	0.302	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0005737	0.710	cytoplasm
GO:0005694	0.617	chromosome
GO:0000785	0.537	chromatin
GO:0120025	0.442	plasma membrane bounded cell projection
GO:0036477	0.429	somatodendritic compartment
GO:0043005	0.428	neuron projection
GO:0030425	0.415	dendrite
GO:0044297	0.367	cell body
GO:0043025	0.359	neuronal cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]