StarFunc result for job id Q96PN6

User Input

>input (1610 residues)
MNTPKEEFQDWPIVRIAAHLPDLIVYGHFSPERPFMDYFDGVLMFVDISGFTAMTEKFSS
AMYMDRGAEQLVEILNYHISAIVEKVLIFGGDILKFAGDALLALWRVERKQLKNIITVVI
KCSLEIHGLFETQEWEEGLDIRVKIGLAAGHISMLVFGDETHSHFLVIGQAVDDVRLAQN
MAQMNDVILSPNCWQLCDRSMIEIESVPDQRAVKVNFLKPPPNFNFDEFFTKCTTFMHYY
PSGEHKNLLRLACTLKPDPELEMSLQKYVMESILKQIDNKQLQGYLSELRPVTIVFVNLM
FEDQDKAEEIGPAIQDAYMHITSVLKIFQGQINKVFMFDKGCSFLCVFGFPGEKVPDELT
HALECAMDIFDFCSQVHKIQTVSIGVASGIVFCGIVGHTVRHEYTVIGQKVNLAARMMMY
YPGIVTCDSVTYNGSNLPAYFFKELPKKVMKGVADSGPLYQYWGRTEKVMFGMACLICNR
KEDYPLLGRNKEINYFMYTMKKFLISNSSQVLMYEGLPGYGKSQILMKIEYLAQGKNHRI
IAISLNKISFHQTFYTIQMFMANVLGLDTCKHYKERQTNLRNKVMTLLDEKFYCLLNDIF
HVQFPISREISRMSTLKKQKQLEILFMKILKLIVKEERIIFIIDEAQFVDSTSWRFMEKL
IRTLPIFIIMSLCPFVNIPCAAARAVIKNRNTTYIVIGAVQPNDISNKICLDLNVSCISK
ELDSYLGEGSCGIPFYCEELLKNLEHHEVLVFQQTESEEKTNRTWNNLFKYSIKLTEKLN
MVTLHSDKESEEVCHLTSGVRLKNLSPPTSLKEISLIQLDSMRLSHQMLVRCAAIIGLTF
TTELLFEILPCWNMKMMIKTLATLVESNIFYCFRNGKELQKALKQNDPSFEVHYRSLSLK
PSEGMDHGEEEQLRELENEVIECHRIRFCNPMMQKTAYELWLKDQRKAMHLKCARFLEED
AHRCDHCRGRDFIPYHHFTVNIRLNALDMDAIKKMAMSHGFKTEEKLILSNSEIPETSAF
FPENRSPEEIREKILNFFDHVLTKMKTSDEDIIPLESCQCEEILEIVILPLAHHFLALGE
NDKALYYFLEIASAYLIFCDNYMAYMYLNEGQKLLKTLKKDKSWSQTFESATFYSLKGEV
CFNMGQIVLAKKMLRKALKLLNRIFPYNLISLFLHIHVEKNRHFHYVNRQAQESPPPGKK
RLAQLYRQTVCLSLLWRIYSYSYLFHCKYYAHLAVMMQMNTALETQNCFQIIKAYLDYSL
YHHLAGYKGVWFKYEVMAMEHIFNLPLKGEGIEIVAYVAETLVFNKLIMGHLDLAIELGS
RALQMWALLQNPNRHYQSLCRLSRCLLLNSRYPQLIQVLGRLWELSVTQEHIFSKAFFYF
VCLDILLYSGFVYRTFEECLEFIHQYENNRILKFHSGLLLGLYSSVAIWYARLQEWDNFY
KFSNRAKNLLPRRTMTLTYYDGISRYMEGQVLHLQKQIKEQSENAQASGEELLKNLENLV
AQNTTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRLSETQGNILEKCWLNMNKESW
YSTSELKEDQWLQTILSLPSWEKIVAGRVNIQDLQKNKFLMRANTVDNHF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C0T9	0.976	0.974	0.000	1614	0.760	0.758	Q8C0T9.pdb.gz	ADCYA_MOUSE Adenylate cyclase type 10 OS=Mus musculus OX=10090 GN=Adcy10 PE=1 SV=2
2	AFDB:Q96PN6	1.000	1.000	0.000	1610	1.000	1.000	Q96PN6.pdb.gz	ADCYA_HUMAN Adenylate cyclase type 10 OS=Homo sapiens OX=9606 GN=ADCY10 PE=1 SV=3
3	AFDB:C0H4R1	0.258	0.183	1.405E-19	2279	0.064	0.045	C0H4R1.pdb.gz	C0H4R1_PLAF7 Adenylyl cyclase beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0802600 PE=4 SV=1
4	AFDB:O53720	0.219	0.296	1.407E-18	1085	0.076	0.112	O53720.pdb.gz	O53720_MYCTU Probable transcriptional regulatory protein (Probably LuxR/UhpA-family) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0386 PE=1 SV=3
5	AFDB:O53213	0.212	0.283	8.089E-17	1137	0.079	0.112	O53213.pdb.gz	O53213_MYCTU Probable transcriptional regulatory protein (LuxR-family) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2488c PE=1 SV=1
6	AFDB:Q11028	0.187	0.244	1.068E-16	1159	0.091	0.127	Q11028.pdb.gz	Q11028_MYCTU Probable transcriptional regulatory protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1358 PE=4 SV=1
7	AFDB:O74539	0.204	0.152	8.429E-16	2344	0.089	0.061	O74539.pdb.gz	MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mak3 PE=1 SV=1
8	AFDB:O14002	0.159	0.127	1.359E-14	2310	0.094	0.065	O14002.pdb.gz	MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mak2 PE=3 SV=1
9	AFDB:Q76L33	0.216	0.389	6.939E-13	860	0.050	0.094	Q76L33.pdb.gz	PCYAB_EUGLO Photoactivated adenylate cyclase subunit beta OS=Euglena longa OX=3037 GN=pacB PE=2 SV=1
10	AFDB:P84737	0.208	0.320	2.574E-12	1019	0.062	0.098	P84737.pdb.gz	PALFB_EUGGR Photoactivated adenylate cyclase subunit alpha-like protein FB OS=Euglena gracilis OX=3039 GN=pacA PE=2 SV=1
11	PDB:6jt0B	0.110	0.293	9.538E-7	576	0.034	0.094	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
12	PDB:7yziA	0.106	0.425	1.538E-5	378	0.025	0.108	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
13	PDB:7d9tA	0.099	0.288	1.803E-5	512	0.024	0.074	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
14	PDB:6jt0A	0.103	0.289	3.991E-5	542	0.023	0.068	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
15	PDB:7d9rA	0.098	0.298	5.706E-5	502	0.022	0.070	7d9rA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
16	PDB:4gyoB	0.165	0.595	5.938E-5	359	0.035	0.156	4gyoB.pdb.gz	Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
17	PDB:7nj0A	0.179	0.233	8.833E-5	1188	0.055	0.075	7nj0A.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
18	PDB:6bq1B	0.135	0.265	1.423E-4	728	0.064	0.141	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
19	PDB:7nj1A	0.160	0.175	1.806E-4	1448	0.050	0.056	7nj1A.pdb.gz
20	PDB:5dseA	0.171	0.406	3.409E-4	537	0.048	0.145	5dseA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C0T9	0.0	2560	1614	0.765	0.763	ADCYA_MOUSE Adenylate cyclase type 10 OS=Mus musculus OX=10090 GN=Adcy10 PE=1 SV=2
2	Q96PN6	0.0	3359	1610	1.000	1.000	ADCYA_HUMAN Adenylate cyclase type 10 OS=Homo sapiens OX=9606 GN=ADCY10 PE=1 SV=3
3	Q9Z286	0.0	2622	1608	0.775	0.775	ADCYA_RAT Adenylate cyclase type 10 OS=Rattus norvegicus OX=10116 GN=Adcy10 PE=1 SV=1
4	Q551V8	2.73e-50	199	2843	0.140	0.079	Q551V8_DICDI Guanylyl cyclase OS=Dictyostelium discoideum OX=44689 GN=sgcA PE=4 SV=1
5	C0H4R1	3.66e-13	77.8	2279	0.031	0.022	C0H4R1_PLAF7 Adenylyl cyclase beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0802600 PE=4 SV=1
6	O06362	2.51e-07	57.8	549	0.029	0.086	O06362_MYCTO Adenylate cyclase, putative OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3748 PE=3 SV=1
7	P9WQ29	2.08e-05	51.6	567	0.030	0.085	Y1320_MYCTU Uncharacterized protein Rv1320c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1320c PE=1 SV=1
8	P72951	7.13e-04	46.6	756	0.020	0.044	P72951_SYNY3 Adenylate cyclase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=cyaA PE=1 SV=1
9	Q9HZ23	0.001	45.8	463	0.020	0.071	Q9HZ23_PSEAE CyaB OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=cyaB PE=1 SV=1
10	P9WQ31	0.004	43.9	535	0.025	0.075	Y1319_MYCTU Uncharacterized protein Rv1319c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1319c PE=1 SV=1
11	Q03100	0.004	44.3	1407	0.020	0.023	CYAA_DICDI Adenylate cyclase, aggregation specific OS=Dictyostelium discoideum OX=44689 GN=acaA PE=1 SV=2
12	M9NDN7	0.007	43.5	1107	0.019	0.028	M9NDN7_DROME Adenylyl cyclase X A, isoform C OS=Drosophila melanogaster OX=7227 GN=ACXA PE=4 SV=1
13	Q9NJA2	0.007	43.5	1112	0.019	0.028	Q9NJA2_DROME Adenylyl cyclase ACXA OS=Drosophila melanogaster OX=7227 GN=ACXA PE=2 SV=1
14	M9PBA8	0.008	43.5	865	0.019	0.036	M9PBA8_DROME Adenylyl cyclase X A, isoform G OS=Drosophila melanogaster OX=7227 GN=ACXA PE=4 SV=1
15	Q9VK51	0.008	43.5	1112	0.019	0.028	Q9VK51_DROME Adenylyl cyclase X A, isoform A OS=Drosophila melanogaster OX=7227 GN=ACXA PE=4 SV=3
16	Q9VEU5	0.013	42.7	669	0.024	0.057	GCYDB_DROME Soluble guanylate cyclase 89Db OS=Drosophila melanogaster OX=7227 GN=Gyc89Db PE=1 SV=1
17	P26770	0.016	42.4	1064	0.017	0.025	ADCY4_RAT Adenylate cyclase type 4 OS=Rattus norvegicus OX=10116 GN=Adcy4 PE=1 SV=1
18	Q8NFM4	0.016	42.4	1077	0.017	0.025	ADCY4_HUMAN Adenylate cyclase type 4 OS=Homo sapiens OX=9606 GN=ADCY4 PE=1 SV=1
19	Q91WF3	0.016	42.4	1077	0.017	0.025	ADCY4_MOUSE Adenylate cyclase type 4 OS=Mus musculus OX=10090 GN=Adcy4 PE=1 SV=1
20	P9WQ33	0.021	42.0	541	0.023	0.068	Y1318_MYCTU Uncharacterized protein Rv1318c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1318c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	4.6	19.1	AAA ATPase domain
2	PF13401 AAA_22	4.5	19.0	AAA domain
3	PF04510 DUF577	12	17.2	Family of unknown function (DUF577)
4	PF00211 Guanylate_cyc	7.6e-23	92.6	Adenylate and Guanylate cyclase catalytic domain
5	PF00515 TPR_1	42	15.4	Tetratricopeptide repeat
6	PF13424 TPR_12	0.085	24.5	Tetratricopeptide repeat
7	PF07719 TPR_2	8.7	17.8	Tetratricopeptide repeat
8	PF13181 TPR_8	35	16.0	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356825

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320171	0.933	Pyruvate kinase PKM
2	9606.ENSP00000334910	0.866	cGMP-dependent 3',5'-cyclic phosphodiesterase
3	9606.ENSP00000356042	0.858	Ezrin
4	9606.ENSP00000306627	0.853	Sodium/hydrogen exchanger 10
5	9606.ENSP00000370078	0.843	cAMP-specific 3',5'-cyclic phosphodiesterase 4A
6	9606.ENSP00000372023	0.842	Serine/threonine-protein kinase Chk2
7	9606.ENSP00000366488	0.839	cAMP-dependent protein kinase catalytic subunit gamma
8	9606.ENSP00000359719	0.833	cAMP-dependent protein kinase catalytic subunit beta
9	9606.ENSP00000309591	0.829	cAMP-dependent protein kinase catalytic subunit alpha
10	9606.ENSP00000332116	0.817	cAMP-specific 3',5'-cyclic phosphodiesterase 4B
11	9606.ENSP00000385632	0.809	High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A
12	9606.ENSP00000310661	0.807	cAMP-specific 3',5'-cyclic phosphodiesterase 7B
13	9606.ENSP00000347046	0.806	cGMP-specific 3',5'-cyclic phosphodiesterase
14	9606.ENSP00000345502	0.805	cAMP-specific 3',5'-cyclic phosphodiesterase 4D
15	9606.ENSP00000347689	0.804	cAMP-specific 3',5'-cyclic phosphodiesterase 4C
16	9606.ENSP00000304336	0.803	Pyrin domain-containing protein 1
17	9606.ENSP00000410309	0.792	Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A
18	9606.ENSP00000438284	0.792	cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
19	9606.ENSP00000255266	0.788	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
20	9606.ENSP00000291539	0.787	High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004016	1.000	adenylate cyclase activity
GO:0043167	0.999	ion binding
GO:0005515	0.996	protein binding
GO:0043168	0.964	anion binding
GO:0071890	0.351	bicarbonate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.969	organic substance metabolic process
GO:0044237	0.957	cellular metabolic process
GO:0044238	0.951	primary metabolic process
GO:0006807	0.933	nitrogen compound metabolic process
GO:0051716	0.867	cellular response to stimulus
GO:1901362	0.862	organic cyclic compound biosynthetic process
GO:0044271	0.861	cellular nitrogen compound biosynthetic process
GO:0019438	0.856	aromatic compound biosynthetic process
GO:0018130	0.855	heterocycle biosynthetic process
GO:1901293	0.845	nucleoside phosphate biosynthetic process
GO:0009117	0.821	nucleotide metabolic process
GO:1901566	0.811	organonitrogen compound biosynthetic process
GO:0009190	0.811	cyclic nucleotide biosynthetic process
GO:0050789	0.793	regulation of biological process
GO:1901137	0.786	carbohydrate derivative biosynthetic process
GO:0009150	0.768	purine ribonucleotide metabolic process
GO:0052652	0.759	cyclic purine nucleotide metabolic process
GO:0009152	0.756	purine ribonucleotide biosynthetic process
GO:0050794	0.730	regulation of cellular process
GO:0046058	0.705	cAMP metabolic process
GO:0042221	0.526	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.987	plasma membrane
GO:0043226	0.978	organelle
GO:0043232	0.974	intracellular non-membrane-bounded organelle
GO:0043227	0.969	membrane-bounded organelle
GO:0005634	0.949	nucleus
GO:0042995	0.805	cell projection
GO:0120025	0.743	plasma membrane bounded cell projection
GO:0005929	0.719	cilium
GO:0005829	0.679	cytosol
GO:0005856	0.660	cytoskeleton
GO:0015630	0.555	microtubule cytoskeleton
GO:0070013	0.513	intracellular organelle lumen
GO:0012505	0.471	endomembrane system
GO:0031981	0.438	nuclear lumen
GO:0048471	0.359	perinuclear region of cytoplasm
GO:0005654	0.301	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15389	1.000	ATP = 3',5'-cyclic AMP + diphosphate
EC:4.6.1.1	1.000	adenylate cyclase.

[back to server]