StarFunc result for job id Q96PN7

User Input

>input (1200 residues)
MGDQQLYKTNHVAHGSENLFYQQPPLGVHSGLNHNYGNAVTGGGMDAPQASPISPHFPQD
TRDGLGLPVGSKNLGQMDTSRQGGWGSHAGPGNHVQLRGNLANSNMMWGAPAQAEPTDGY
QYTYSQASEIRTQKLTSGVLHKLDSFTQVFANQNLRIQVNNMAQVLHTQSAVMDGAPDSA
LRQLLSQKPMEPPAPAIPSRYQQVPQQPHPGFTGGLSKPALQVGQHPTQGHLYYDYQQPL
AQVPVQGGQPLQAPQMLSQHMQQMQQHQYYPPQQQQQAGQQRISMQEIQTQPQQIRPSQP
QPPPQQQQPQQLQLQQRQGSMQIPQYYQPQPMMQHLQEQQQQQMHLQPPSYHRDPHQYTP
EQAHTVQLIPLGSMSQYYYQEPQQPYSHPLYQQSHLSQHQQREDSQLKTYSSDRQAQAML
SSHGDLGPPDTGMGDPASSDLTRVSSTLPHRPLLSPSGIHLNNMGPQHQQLSPSAMWPQM
HLPDGRAQPGSPESSGQPKGAFGEQFDAKNKLTCSICLKEFKNLPALNGHMRSHGGMRAS
PNLKQEEGEKVLPPQPQPPLPPPPPPPPPPQLPPEAESLTPMVMPVSVPVKLLPPKPSSQ
GFTNSTVAAPSARDKPASSMSDDEMPVLEIPRKHQPSVPKAEEPLKTVQEKKKFRHRPEP
LFIPPPPSYNPNPAASYSGATLYQSQLRSPRVLGDHLLLDPTHELPPYTPPPMLSPVRQG
SGLFSNVLISGHGPGAHPQLPLTPLTPTPRVLLCRSNSIDGSNVTVTPGPGEQTVDVEPR
INIGLRFQAEIPELQDISALAQDTHKATLVWKPWPELENHDLQQRVENLLNLCCSSALPG
GGTNSEFALHSLFEAKGDVMVALEMLLLRKPVRLKCHPLANYHYAGSDKWTSLERKLFNK
ALATYSKDFIFVQKMVKSKTVAQCVEYYYTWKKIMRLGRKHRTRLAEIIDDCVTSEEEEE
LEEEEEEDPEEDRKSTKEEESEVPKSPEPPPVPVLAPTEGPPLQALGQPSGSFICEMPNC
GAVFSSRQALNGHARIHGGTNQVTKARGAIPSGKQKPGGTQSGYCSVKSSPSHSTTSGET
DPTTIFPCKECGKVFFKIKSRNAHMKTHRQQEEQQRQKAQKAAFAAEMAATIERTTGPVG
APGLLPLDQLSLIKPIKDVDILDDDVVQQLGGVMEEAEVVDTDLLLDDQDSVLLQGDAEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05GC8	0.283	0.279	0.000	1220	0.999	0.983	Q05GC8.pdb.gz	Q05GC8_HUMAN Breast cancer anti-estrogen resistance 2 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
2	AFDB:Q96PN7	0.999	0.999	0.000	1200	1.000	1.000	Q96PN7.pdb.gz	TREF1_HUMAN Transcriptional-regulating factor 1 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
3	AFDB:A0A1C7CYX1	0.167	0.181	2.490E-35	1099	0.265	0.289	A0A1C7CYX1.pdb.gz	A0A1C7CYX1_HUMAN Mitotic deacetylase associated SANT domain protein OS=Homo sapiens OX=9606 GN=MIDEAS PE=1 SV=1
4	AFDB:Q9H0D2	0.137	0.123	1.002E-26	1346	0.232	0.207	Q9H0D2.pdb.gz	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3
5	AFDB:Q0GGX2	0.146	0.130	2.120E-24	1363	0.243	0.214	Q0GGX2.pdb.gz	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1
6	PDB:7aoaD	0.111	0.356	2.949E-5	343	0.032	0.111	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
7	AFDB:O64572	0.047	0.046	3.215E-4	1211	0.133	0.132	O64572.pdb.gz	O64572_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g19390 PE=1 SV=2
8	AFDB:Q569L8	0.037	0.034	3.215E-4	1344	0.137	0.122	Q569L8.pdb.gz	CENPJ_MOUSE Centromere protein J OS=Mus musculus OX=10090 GN=Cenpj PE=2 SV=2
9	AFDB:Q9VED3	0.040	0.040	4.595E-4	1186	0.141	0.142	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
10	AFDB:Q80XI3	0.052	0.047	5.492E-4	1579	0.161	0.122	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
11	AFDB:Q9HC77	0.041	0.037	5.829E-4	1338	0.135	0.121	Q9HC77.pdb.gz	CENPJ_HUMAN Centromere protein J OS=Homo sapiens OX=9606 GN=CENPJ PE=1 SV=2
12	PDB:7vdvW	0.040	0.172	3.302E-2	248	0.028	0.137	7vdvW.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
13	PDB:6lthO	0.040	0.128	5.987E-2	325	0.028	0.102	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
14	PDB:1oqyA	0.043	0.107	1.646E-1	363	0.019	0.063	1oqyA.pdb.gz
15	PDB:7vdvX	0.033	0.147	1.646E-1	252	0.022	0.107	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
16	PDB:4czzB	0.040	0.331	5.099E-1	133	0.020	0.180	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
17	PDB:7dcoL	0.043	0.109	6.468E-1	435	0.016	0.044	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
18	PDB:3bviF	0.033	0.128	9.810E-1	173	0.014	0.098	3bviF.pdb.gz	Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
19	PDB:6k15H	0.041	0.115	1.041	393	0.013	0.038	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
20	PDB:5l3cB	0.039	0.305	1.105	134	0.022	0.194	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q05GC8	0.0	2430	1220	1.000	0.984	Q05GC8_HUMAN Breast cancer anti-estrogen resistance 2 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
2	Q96PN7	0.0	2442	1200	1.000	1.000	TREF1_HUMAN Transcriptional-regulating factor 1 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
3	A0A1C7CYX1	4.44e-85	302	1099	0.186	0.203	A0A1C7CYX1_HUMAN Mitotic deacetylase associated SANT domain protein OS=Homo sapiens OX=9606 GN=MIDEAS PE=1 SV=1
4	Q6PJG2	9.04e-75	271	1045	0.155	0.178	MDEAS_HUMAN Mitotic deacetylase-associated SANT domain protein OS=Homo sapiens OX=9606 GN=MIDEAS PE=1 SV=2
5	Q9H0D2	2.13e-69	258	1346	0.153	0.137	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3
6	Q0GGX2	8.57e-69	256	1363	0.134	0.118	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1
7	Q20733	6.86e-15	82.4	900	0.048	0.063	SAEG1_CAEEL Suppressor of activated egl-4 protein 1 OS=Caenorhabditis elegans OX=6239 GN=saeg-1 PE=1 SV=2
8	A8WHS4	2.75e-14	80.1	676	0.048	0.084	A8WHS4_CAEEL Suppressor of activated egl-4 protein 1 OS=Caenorhabditis elegans OX=6239 GN=saeg-1 PE=1 SV=1
9	A8WHS5	4.64e-14	79.0	580	0.049	0.102	A8WHS5_CAEEL Suppressor of activated egl-4 protein 1 OS=Caenorhabditis elegans OX=6239 GN=saeg-1 PE=1 SV=1
10	Q6PGA0	1.62e-10	67.4	451	0.043	0.115	RCOR3_MOUSE REST corepressor 3 OS=Mus musculus OX=10090 GN=Rcor3 PE=1 SV=2
11	Q7Z3K6	2.26e-10	67.0	550	0.051	0.111	MIER3_HUMAN Mesoderm induction early response protein 3 OS=Homo sapiens OX=9606 GN=MIER3 PE=1 SV=2
12	Q9P2K3	2.12e-09	63.9	495	0.045	0.109	RCOR3_HUMAN REST corepressor 3 OS=Homo sapiens OX=9606 GN=RCOR3 PE=1 SV=2
13	Q8IZ40	4.62e-09	62.8	523	0.050	0.115	RCOR2_HUMAN REST corepressor 2 OS=Homo sapiens OX=9606 GN=RCOR2 PE=1 SV=2
14	Q8C796	5.13e-09	62.8	523	0.047	0.107	RCOR2_MOUSE REST corepressor 2 OS=Mus musculus OX=10090 GN=Rcor2 PE=1 SV=1
15	Q5FWT8	8.02e-09	62.0	523	0.047	0.107	RCOR2_RAT REST corepressor 2 OS=Rattus norvegicus OX=10116 GN=Rcor2 PE=1 SV=1
16	Q80TZ9	8.41e-09	62.8	1558	0.050	0.039	RERE_MOUSE Arginine-glutamic acid dipeptide repeats protein OS=Mus musculus OX=10090 GN=Rere PE=1 SV=3
17	Q6NRZ0	1.29e-08	61.2	503	0.049	0.117	RCOR2_XENLA REST corepressor 2 OS=Xenopus laevis OX=8355 GN=rcor2 PE=2 SV=1
18	Q9P2R6	2.59e-08	61.2	1566	0.049	0.038	RERE_HUMAN Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens OX=9606 GN=RERE PE=1 SV=2
19	Q59E36	2.97e-08	60.5	590	0.061	0.124	RCOR_DROME REST corepressor OS=Drosophila melanogaster OX=7227 GN=CoRest PE=1 SV=2
20	E7FF48	1.41e-07	58.9	2315	0.028	0.014	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01448 ELM2	1.4e-05	37.1	ELM2 domain
2	PF00249 Myb_DNA-binding	3.4	19.3	Myb-like DNA-binding domain
3	PF15963 Myb_DNA-bind_7	93	14.3	Myb DNA-binding like
4	PF00096 zf-C2H2	0.0019	29.7	Zinc finger, C2H2 type
5	PF12756 zf-C2H2_2	34	16.2	C2H2 type zinc-finger (2 copies)
6	PF13894 zf-C2H2_4	4.2e-06	38.1	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	3.2e-13	60.6	C2H2-type zinc finger
8	PF16278 zf-C2HE	7.4e+02	12.0	C2HE / C2H2 / C2HC zinc-binding finger
9	PF12874 zf-met	15	17.3	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000439689

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361705	0.931	Deoxynucleotidyltransferase terminal-interacting protein 1
2	9606.ENSP00000362649	0.783	Histone deacetylase 1
3	9606.ENSP00000362690	0.765	Steroidogenic factor 1
4	9606.ENSP00000383042	0.709	Lysine-specific histone demethylase 1A
5	9606.ENSP00000364885	0.703	Zinc finger and BTB domain-containing protein 17
6	9606.ENSP00000262134	0.688	Lysophosphatidylcholine acyltransferase 2
7	9606.ENSP00000356575	0.685	Transcription factor HIVEP2
8	9606.ENSP00000344635	0.651	Cyclin-G1
9	9606.ENSP00000263253	0.635	Histone acetyltransferase p300
10	9606.ENSP00000373340	0.626	Peregrin
11	9606.ENSP00000286523	0.577	ELM2 and Myb/SANT domain containing 1
12	9606.ENSP00000262367	0.575	CREB-binding protein
13	9606.ENSP00000430432	0.558	Histone deacetylase 2
14	9606.ENSP00000323847	0.555	ADP-ribosylation factor-like protein 14
15	9606.ENSP00000404570	0.516	Myosin-13
16	9606.ENSP00000417303	0.510	Krueppel-like factor 8
17	9606.ENSP00000283629	0.506	Upstream-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030374	1.000	nuclear receptor coactivator activity
GO:0001223	1.000	transcription coactivator binding
GO:0016922	1.000	nuclear receptor binding
GO:0033142	0.970	nuclear progesterone receptor binding
GO:0019899	0.469	enzyme binding
GO:0003714	0.369	transcription corepressor activity
GO:0003676	0.345	nucleic acid binding
GO:0003677	0.322	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0019219	0.986	regulation of nucleobase-containing compound metabolic process
GO:0045944	0.982	positive regulation of transcription by RNA polymerase II
GO:0051716	0.981	cellular response to stimulus
GO:0070887	0.965	cellular response to chemical stimulus
GO:0032870	0.962	cellular response to hormone stimulus
GO:0007165	0.956	signal transduction
GO:0009755	0.931	hormone-mediated signaling pathway
GO:0071383	0.925	cellular response to steroid hormone stimulus
GO:0030518	0.922	intracellular steroid hormone receptor signaling pathway
GO:1901700	0.911	response to oxygen-containing compound
GO:1901701	0.807	cellular response to oxygen-containing compound
GO:1901654	0.770	response to ketone
GO:0032570	0.414	response to progesterone
GO:1901655	0.391	cellular response to ketone
GO:0048519	0.375	negative regulation of biological process
GO:0008152	0.319	metabolic process
GO:0048523	0.318	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0001650	0.999	fibrillar center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]