StarFunc result for job id Q96PP8

User Input

>input (586 residues)
MALEIHMSDPMCLIENFNEQLKVNQEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KNKGFSVASTVQSHTKGIWIWCVPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQIFALAL
LLSSTFVYNTVNKIDQGAIDLLHNVTELTDLLKARNSPDLDRVEDPADSASFFPDLVWTL
RDFCLGLEIDGQLVTPDEYLENSLRPKQGSDQRVQNFNLPRLCIQKFFPKKKCFIFDLPA
HQKKLAQLETLPDDELEPEFVQQVTEFCSYIFSHSMTKTLPGGIMVNGSRLKNLVLTYVN
AISSGDLPCIENAVLALAQRENSAAVQKAIAHYDQQMGQKVQLPMETLQELLDLHRTSER
EAIEVFMKNSFKDVDQSFQKELETLLDAKQNDICKRNLEASSDYCSALLKDIFGPLEEAV
KQGIYSKPGGHNLFIQKTEELKAKYYREPRKGIQAEEVLQKYLKSKESVSHAILQTDQAL
TETEKKKKEAQVKAEAEKAEAQRLAAIQRQNEQMMQERERLHQEQVRQMEIAKQNWLAEQ
QKMQEQQMQEQAAQLSTTFQAQNRSLLSELQHAQRTVNNDDPCVLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96PP8	1.000	1.000	7.804E-99	586	1.000	1.000	Q96PP8.pdb.gz	GBP5_HUMAN Guanylate-binding protein 5 OS=Homo sapiens OX=9606 GN=GBP5 PE=1 SV=1
2	AFDB:Q8CFB4	0.913	0.907	4.422E-76	590	0.667	0.663	Q8CFB4.pdb.gz	GBP5_MOUSE Guanylate-binding protein 5 OS=Mus musculus OX=10090 GN=Gbp5 PE=1 SV=2
3	AFDB:Q9H0R5	0.786	0.775	5.540E-68	595	0.676	0.666	Q9H0R5.pdb.gz	GBP3_HUMAN Guanylate-binding protein 3 OS=Homo sapiens OX=9606 GN=GBP3 PE=1 SV=3
4	AFDB:P32456	0.790	0.784	3.471E-66	591	0.642	0.636	P32456.pdb.gz	GBP2_HUMAN Guanylate-binding protein 2 OS=Homo sapiens OX=9606 GN=GBP2 PE=1 SV=3
5	AFDB:P32455	0.783	0.775	5.334E-66	592	0.648	0.642	P32455.pdb.gz	GBP1_HUMAN Guanylate-binding protein 1 OS=Homo sapiens OX=9606 GN=GBP1 PE=1 SV=2
6	AFDB:B2XWS1	0.782	0.777	6.268E-66	590	0.637	0.632	B2XWS1.pdb.gz	B2XWS1_PIG Guanylate binding protein 1 OS=Sus scrofa OX=9823 GN=GBP1 PE=1 SV=1
7	AFDB:Q9Z0E6	0.787	0.783	1.953E-64	589	0.582	0.579	Q9Z0E6.pdb.gz	GBP2_MOUSE Guanylate-binding protein 2 OS=Mus musculus OX=10090 GN=Gbp2 PE=1 SV=1
8	AFDB:Q01514	0.789	0.785	2.460E-62	589	0.596	0.593	Q01514.pdb.gz	GBP1_MOUSE Guanylate-binding protein 1 OS=Mus musculus OX=10090 GN=Gbp1 PE=1 SV=1
9	AFDB:Q6ZN66	0.741	0.689	2.520E-59	633	0.483	0.447	Q6ZN66.pdb.gz	GBP6_HUMAN Guanylate-binding protein 6 OS=Homo sapiens OX=9606 GN=GBP6 PE=1 SV=1
10	AFDB:Q96PP9	0.767	0.705	1.566E-58	640	0.493	0.452	Q96PP9.pdb.gz	GBP4_HUMAN Guanylate-binding protein 4 OS=Homo sapiens OX=9606 GN=GBP4 PE=1 SV=2
11	PDB:7m1sA	0.762	0.773	2.479E-58	577	0.633	0.643	7m1sA.pdb.gz
12	PDB:6lojB	0.750	0.769	9.075E-57	571	0.659	0.676	6lojB.pdb.gz	Substrate-binding destabilizes the hydrophobic cluster to relieve the autoinhibition of bacterial ubiquitin ligase IpaH9.8.
13	PDB:6k1zA	0.712	0.766	1.027E-54	544	0.618	0.665	6k1zA.pdb.gz	Structural mechanism for guanylate-binding proteins (GBPs) targeting by the Shigella E3 ligase IpaH9.8.
14	PDB:3x1dA	0.436	0.631	2.696E-14	381	0.147	0.226	3x1dA.pdb.gz	Comparison of human and Drosophila atlastin GTPases
15	PDB:7pw4C	0.313	0.555	3.150E-8	310	0.101	0.190	7pw4C.pdb.gz	Cryo-EM reconstructions of inhibitor-bound SMG1 kinase reveal an autoinhibitory state dependent on SMG8.
16	PDB:3zjcE	0.230	0.397	7.052E-8	286	0.084	0.171	3zjcE.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
17	PDB:3zjcF	0.217	0.409	4.187E-6	252	0.078	0.183	3zjcF.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
18	PDB:1tq6A	0.188	0.254	7.562E-6	402	0.068	0.100	1tq6A.pdb.gz	Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
19	PDB:6z3eA	0.220	0.445	3.226E-5	237	0.055	0.135	6z3eA.pdb.gz	Crystal structure of GDP-bound human GIMAP5
20	PDB:7po27	0.179	0.183	4.454E-5	571	0.048	0.049	7po27.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JDV3	547	611	0.469	0.450	GBP6_MOUSE Guanylate-binding protein 6 OS=Mus musculus OX=10090 GN=Gbp6 PE=2 SV=2
2	B2XWS1	758	590	0.638	0.634	B2XWS1_PIG Guanylate binding protein 1 OS=Sus scrofa OX=9823 GN=GBP1 PE=1 SV=1
3	L7N1X8	551	611	0.471	0.452	L7N1X8_MOUSE Predicted gene 43302 OS=Mus musculus OX=10090 GN=Gm43302 PE=3 SV=2
4	P32455	804	592	0.676	0.669	GBP1_HUMAN Guanylate-binding protein 1 OS=Homo sapiens OX=9606 GN=GBP1 PE=1 SV=2
5	P32456	761	591	0.643	0.638	GBP2_HUMAN Guanylate-binding protein 2 OS=Homo sapiens OX=9606 GN=GBP2 PE=1 SV=3
6	Q000W5	537	611	0.459	0.440	Q000W5_MOUSE Guanylate-binding protein 10 OS=Mus musculus OX=10090 GN=Gbp10 PE=2 SV=1
7	Q01514	701	589	0.592	0.589	GBP1_MOUSE Guanylate-binding protein 1 OS=Mus musculus OX=10090 GN=Gbp1 PE=1 SV=1
8	Q29RG2	536	611	0.459	0.440	Q29RG2_MOUSE Guanylate-binding protein 10 OS=Mus musculus OX=10090 GN=Gbp10 PE=2 SV=1
9	Q2M1J9	533	611	0.457	0.439	Q2M1J9_MOUSE Guanylate-binding protein 10 OS=Mus musculus OX=10090 GN=Gbp10 PE=2 SV=1
10	Q61107	584	620	0.488	0.461	GBP3_MOUSE Guanylate-binding protein 3 OS=Mus musculus OX=10090 GN=Gbp3 PE=1 SV=1
11	Q6PG83	536	619	0.457	0.433	Q6PG83_MOUSE cDNA sequence BC057170 OS=Mus musculus OX=10090 GN=Gbp9 PE=2 SV=1
12	Q6ZN66	594	633	0.512	0.474	GBP6_HUMAN Guanylate-binding protein 6 OS=Homo sapiens OX=9606 GN=GBP6 PE=1 SV=1
13	Q8BTS3	533	619	0.454	0.430	Q8BTS3_MOUSE Guanylate-binding protein 9 OS=Mus musculus OX=10090 GN=Gbp9 PE=1 SV=1
14	Q8CFB4	769	590	0.652	0.647	GBP5_MOUSE Guanylate-binding protein 5 OS=Mus musculus OX=10090 GN=Gbp5 PE=1 SV=2
15	Q8N8V2	580	638	0.524	0.481	GBP7_HUMAN Guanylate-binding protein 7 OS=Homo sapiens OX=9606 GN=GBP7 PE=1 SV=2
16	Q91Z40	591	638	0.493	0.453	GBP7_MOUSE Guanylate-binding protein 7 OS=Mus musculus OX=10090 GN=Gbp7 PE=1 SV=2
17	Q96PP8	1213	586	1.000	1.000	GBP5_HUMAN Guanylate-binding protein 5 OS=Homo sapiens OX=9606 GN=GBP5 PE=1 SV=1
18	Q96PP9	593	640	0.493	0.452	GBP4_HUMAN Guanylate-binding protein 4 OS=Homo sapiens OX=9606 GN=GBP4 PE=1 SV=2
19	Q9H0R5	793	595	0.671	0.661	GBP3_HUMAN Guanylate-binding protein 3 OS=Homo sapiens OX=9606 GN=GBP3 PE=1 SV=3
20	Q9Z0E6	696	589	0.604	0.601	GBP2_MOUSE Guanylate-binding protein 2 OS=Mus musculus OX=10090 GN=Gbp2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	1.2e+02	14.2	AAA domain
2	PF02263 GBP	2.9e-116	398.9	Guanylate-binding protein, N-terminal domain
3	PF02841 GBP_C	1.1e-112	387.8	Guanylate-binding protein, C-terminal domain
4	PF01926 MMR_HSR1	0.73	21.3	50S ribosome-binding GTPase
5	PF05879 RHD3_GTPase	4.1	18.3	Root hair defective 3 GTP-binding protein (RHD3) GTPase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359488

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337383	0.975	NACHT, LRR and PYD domains-containing protein 3
2	9606.ENSP00000359497	0.928	Guanylate-binding protein 2
3	9606.ENSP00000359504	0.814	Guanylate-binding protein 1
4	9606.ENSP00000305651	0.812	C-X-C motif chemokine 10
5	9606.ENSP00000354901	0.803	C-X-C motif chemokine 9
6	9606.ENSP00000354394	0.796	Signal transducer and activator of transcription 1-alpha/beta
7	9606.ENSP00000301956	0.690	Acyl-coenzyme A synthetase ACSM1, mitochondrial
8	9606.ENSP00000245414	0.661	Interferon regulatory factor 1
9	9606.ENSP00000357112	0.647	Interferon-inducible protein AIM2
10	9606.ENSP00000360891	0.635	Interferon-induced protein with tetratricopeptide repeats 2
11	9606.ENSP00000305647	0.628	Vesicle-associated membrane protein 5
12	9606.ENSP00000274306	0.622	Granzyme A
13	9606.ENSP00000354822	0.618	XIAP-associated factor 1
14	9606.ENSP00000306884	0.613	C-X-C motif chemokine 11
15	9606.ENSP00000371471	0.611	Radical S-adenosyl methionine domain-containing protein 2
16	9606.ENSP00000360883	0.600	Interferon-induced protein with tetratricopeptide repeats 3
17	9606.ENSP00000326247	0.595	Sterile alpha motif domain-containing protein 9-like
18	9606.ENSP00000381601	0.588	Interferon-induced GTP-binding protein Mx1
19	9606.ENSP00000433138	0.587	Caspase-1
20	9606.ENSP00000359490	0.580	Guanylate-binding protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0042802	0.992	identical protein binding
GO:0042803	0.980	protein homodimerization activity
GO:0097159	0.869	organic cyclic compound binding
GO:1901363	0.867	heterocyclic compound binding
GO:0097367	0.785	carbohydrate derivative binding
GO:0000166	0.726	nucleotide binding
GO:0017076	0.719	purine nucleotide binding
GO:0032553	0.677	ribonucleotide binding
GO:0032555	0.669	purine ribonucleotide binding
GO:0003824	0.638	catalytic activity
GO:0016787	0.633	hydrolase activity
GO:0005525	0.377	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006952	0.996	defense response
GO:0051707	0.996	response to other organism
GO:0002376	0.995	immune system process
GO:0070887	0.995	cellular response to chemical stimulus
GO:0071346	0.988	cellular response to type II interferon
GO:0050789	0.918	regulation of biological process
GO:0050794	0.816	regulation of cellular process
GO:0048518	0.798	positive regulation of biological process
GO:0019222	0.607	regulation of metabolic process
GO:0060255	0.574	regulation of macromolecule metabolic process
GO:0048583	0.567	regulation of response to stimulus
GO:0001817	0.515	regulation of cytokine production
GO:0010604	0.386	positive regulation of macromolecule metabolic process
GO:0048519	0.380	negative regulation of biological process
GO:0048522	0.333	positive regulation of cellular process
GO:0001819	0.333	positive regulation of cytokine production
GO:0080134	0.302	regulation of response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0016020	0.982	membrane
GO:0005829	0.939	cytosol
GO:0005576	0.779	extracellular region
GO:0031982	0.674	vesicle
GO:0031410	0.647	cytoplasmic vesicle
GO:0005794	0.645	Golgi apparatus
GO:0048471	0.323	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.633	Hydrolases.

[back to server]