StarFunc result for job id Q96PQ0

User Input

>input (1159 residues)
MAHRGPSRASKGPGPTARAPSPGAPPPPRSPRSRPLLLLLLLLGACGAAGRSPEPGRLGP
HAQLTRVPRSPPAGRAEPGGGEDRQARGTEPGAPGPSPGPAPGPGEDGAPAAGYRRWERA
APLAGVASRAQVSLISTSFVLKGDATHNQAMVHWTGENSSVILILTKYYHADMGKVLESS
LWRSSDFGTSYTKLTLQPGVTTVIDNFYICPTNKRKVILVSSSLSDRDQSLFLSADEGAT
FQKQPIPFFVETLIFHPKEEDKVLAYTKESKLYVSSDLGKKWTLLQERVTKDHVFWSVSG
VDADPDLVHVEAQDLGGDFRYVTCAIHNCSEKMLTAPFAGPIDHGSLTVQDDYIFFKATS
ANQTKYYVSYRRNEFVLMKLPKYALPKDLQIISTDESQVFVAVQEWYQMDTYNLYQSDPR
GVRYALVLQDVRSSRQAEESVLIDILEVRGVKGVFLANQKIDGKVMTLITYNKGRDWDYL
RPPSMDMNGKPTNCKPPDCHLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQLVEY
KEEMYITSDCGHTWRQVFEEEHHILYLDHGGVIVAIKDTSIPLKILKFSVDEGLTWSTHN
FTSTSVFVDGLLSEPGDETLVMTVFGHISFRSDWELVKVDFRPSFSRQCGEEDYSSWELS
NLQGDRCIMGQQRSFRKRKSTSWCIKGRSFTSALTSRVCECRDSDFLCDYGFERSSSSES
STNKCSANFWFNPLSPPDDCALGQTYTSSLGYRKVVSNVCEGGVDMQQSQVQLQCPLTPP
RGLQVSIQGEAVAVRPGEDVLFVVRQEQGDVLTTKYQVDLGDGFKAMYVNLTLTGEPIRH
RYESPGIYRVSVRAENTAGHDEAVLFVQVNSPLQALYLEVVPVIGLNQEVNLTAVLLPLN
PNLTVFYWWIGHSLQPLLSLDNSVTTRFSDTGDVRVTVQAACGNSVLQDSRVLRVLDQFQ
VMPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQELLVTVVKPGLPTLADLYVL
LPPPRPTRKRSLSSDKRLAAIQQVLNAQKISFLLRGGVRVLVALRDTGTGAEQLGGGGGY
WAVVVLFVIGLFAAGAFILYKFKRKRPGRTVYAQMHNEKEQEMTSPVSHSEDVQGAVQGN
HSGVVLSINSREMHSYLVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WY21	0.749	0.743	0.000	1168	0.433	0.430	Q8WY21.pdb.gz	SORC1_HUMAN VPS10 domain-containing receptor SorCS1 OS=Homo sapiens OX=9606 GN=SORCS1 PE=1 SV=3
2	AFDB:Q96PQ0	1.000	1.000	0.000	1159	1.000	1.000	Q96PQ0.pdb.gz	SORC2_HUMAN VPS10 domain-containing receptor SorCS2 OS=Homo sapiens OX=9606 GN=SORCS2 PE=1 SV=3
3	AFDB:Q9EPR5	0.876	0.876	0.000	1159	0.860	0.860	Q9EPR5.pdb.gz	SORC2_MOUSE VPS10 domain-containing receptor SorCS2 OS=Mus musculus OX=10090 GN=Sorcs2 PE=1 SV=2
4	PDB:5nmtB	0.466	0.798	1.478E-40	657	0.142	0.251	5nmtB.pdb.gz
5	AFDB:B7YZW3	0.106	0.067	6.186E-10	2064	0.111	0.062	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
6	AFDB:A0A0G2K0H3	0.112	0.089	7.488E-10	1613	0.087	0.063	A0A0G2K0H3.pdb.gz	A0A0G2K0H3_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp6 PE=3 SV=1
7	PDB:5a42A	0.077	0.060	2.341E-9	1597	0.089	0.064	5a42A.pdb.gz
8	AFDB:A0A2R8QL08	0.104	0.066	3.985E-9	2036	0.106	0.060	A0A2R8QL08.pdb.gz
9	PDB:7eebE	0.118	0.126	7.728E-9	1053	0.074	0.082	7eebE.pdb.gz	Structure of a mammalian sperm cation channel complex.
10	PDB:7mq8LT	0.132	0.166	8.919E-9	869	0.068	0.091	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:6jp6A	0.133	0.148	1.132E-8	998	0.072	0.083	6jp6A.pdb.gz
12	PDB:6qk7B	0.137	0.188	1.371E-8	749	0.075	0.116	6qk7B.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
13	AFDB:F1R2D2	0.099	0.073	1.592E-8	1687	0.108	0.074	F1R2D2.pdb.gz
14	AFDB:Q62234	0.071	0.057	4.139E-8	1667	0.114	0.079	Q62234.pdb.gz	MYOM1_MOUSE Myomesin-1 OS=Mus musculus OX=10090 GN=Myom1 PE=1 SV=2
15	PDB:6n8sA	0.147	0.187	4.314E-8	834	0.071	0.098	6n8sA.pdb.gz
16	PDB:6qk7A	0.166	0.166	1.234E-7	1161	0.076	0.076	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
17	PDB:5m2nA	0.150	0.209	1.294E-7	711	0.077	0.125	5m2nA.pdb.gz
18	PDB:6h03A	0.075	0.074	1.358E-7	1223	0.090	0.085	6h03A.pdb.gz
19	AFDB:H0YL70	0.141	0.193	3.386E-7	782	0.060	0.090	H0YL70.pdb.gz	H0YL70_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
20	AFDB:E9Q4Y4	0.063	0.036	4.299E-7	2514	0.110	0.051	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5MED8	0.0	2039	987	0.850	0.998	B5MED8_HUMAN Sortilin related VPS10 domain containing receptor 2 OS=Homo sapiens OX=9606 GN=SORCS2 PE=1 SV=4
2	Q17R88	0.0	974	1222	0.436	0.413	Q17R88_HUMAN Sortilin-related VPS10 domain containing receptor 3 OS=Homo sapiens OX=9606 GN=SORCS3 PE=2 SV=1
3	Q8VI51	0.0	971	1219	0.424	0.403	SORC3_MOUSE VPS10 domain-containing receptor SorCS3 OS=Mus musculus OX=10090 GN=Sorcs3 PE=1 SV=1
4	Q8WY21	0.0	981	1168	0.416	0.413	SORC1_HUMAN VPS10 domain-containing receptor SorCS1 OS=Homo sapiens OX=9606 GN=SORCS1 PE=1 SV=3
5	Q96PQ0	0.0	2394	1159	1.000	1.000	SORC2_HUMAN VPS10 domain-containing receptor SorCS2 OS=Homo sapiens OX=9606 GN=SORCS2 PE=1 SV=3
6	Q9EPR5	0.0	2043	1159	0.861	0.861	SORC2_MOUSE VPS10 domain-containing receptor SorCS2 OS=Mus musculus OX=10090 GN=Sorcs2 PE=1 SV=2
7	Q9JLC4	0.0	966	1167	0.434	0.431	SORC1_MOUSE VPS10 domain-containing receptor SorCS1 OS=Mus musculus OX=10090 GN=Sorcs1 PE=1 SV=1
8	Q9UPU3	0.0	973	1222	0.420	0.399	SORC3_HUMAN VPS10 domain-containing receptor SorCS3 OS=Homo sapiens OX=9606 GN=SORCS3 PE=1 SV=2
9	O88307	9.40e-72	266	2215	0.181	0.095	SORL_MOUSE Sortilin-related receptor OS=Mus musculus OX=10090 GN=Sorl1 PE=1 SV=3
10	P0DSP1	9.72e-71	263	2215	0.165	0.086	SORL_RAT Sortilin-related receptor OS=Rattus norvegicus OX=10116 GN=Sorl1 PE=1 SV=1
11	Q92673	1.21e-69	259	2214	0.164	0.086	SORL_HUMAN Sortilin-related receptor OS=Homo sapiens OX=9606 GN=SORL1 PE=1 SV=2
12	Q95209	3.77e-68	254	2213	0.162	0.085	SORL_RABIT Sortilin-related receptor OS=Oryctolagus cuniculus OX=9986 GN=SORL1 PE=1 SV=1
13	E1BKZ9	1.11e-65	241	876	0.164	0.217	E1BKZ9_BOVIN Sortilin 1 OS=Bos taurus OX=9913 GN=SORT1 PE=4 SV=2
14	Q6PHU5	3.50e-64	236	825	0.160	0.224	SORT_MOUSE Sortilin OS=Mus musculus OX=10090 GN=Sort1 PE=1 SV=1
15	Q99523	1.24e-63	234	831	0.153	0.213	SORT_HUMAN Sortilin OS=Homo sapiens OX=9606 GN=SORT1 PE=1 SV=3
16	O54861	2.54e-62	231	825	0.156	0.219	SORT_RAT Sortilin OS=Rattus norvegicus OX=10116 GN=Sort1 PE=1 SV=3
17	A5PMG8	1.73e-58	219	828	0.150	0.210	A5PMG8_DANRE Sortilin 1b OS=Danio rerio OX=7955 GN=sort1 PE=1 SV=1
18	P32319	2.04e-40	165	1579	0.135	0.099	VPS10_YEAST Vacuolar protein sorting/targeting protein VPS10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEP1 PE=1 SV=1
19	P53751	3.35e-39	161	1116	0.112	0.116	YN94_YEAST Uncharacterized membrane glycoprotein YNR065C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNR065C PE=4 SV=1
20	P40438	2.19e-38	159	1549	0.135	0.101	VTH1_YEAST VPS10 homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VTH1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15899 BNR_6	0.028	25.5	BNR-Asp box repeat
2	PF00801 PKD	4.8e-06	37.6	PKD domain
3	PF18911 PKD_4	6.7e-05	34.2	PKD domain
4	PF15902 Sortilin-Vps10	5e-96	333.9	Sortilin, neurotensin receptor 3,
5	PF15901 Sortilin_C	9.2e-33	125.5	Sortilin, neurotensin receptor 3, C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000422185

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000172229	0.988	Tumor necrosis factor receptor superfamily member 16
2	9606.ENSP00000277120	0.932	BDNF/NT-3 growth factors receptor
3	9606.ENSP00000358525	0.885	Beta-nerve growth factor
4	9606.ENSP00000299138	0.884	Vacuolar protein sorting-associated protein 35
5	9606.ENSP00000414303	0.761	Brain-derived neurotrophic factor
6	9606.ENSP00000362480	0.667	Vacuolar protein sorting-associated protein 26A
7	9606.ENSP00000271332	0.661	Cadherin EGF LAG seven-pass G-type receptor 2
8	9606.ENSP00000358925	0.646	Proline/serine-rich coiled-coil protein 1
9	9606.ENSP00000478310	0.631	Signal peptidase complex subunit 1
10	9606.ENSP00000281187	0.626	Vacuolar protein sorting-associated protein 26B
11	9606.ENSP00000245105	0.601	SH3 domain and tetratricopeptide repeats 1
12	9606.ENSP00000397297	0.598	Neurotrophin-3
13	9606.ENSP00000482968	0.592	Alstrom syndrome protein 1
14	9606.ENSP00000410689	0.586	Actin filament-associated protein 1
15	9606.ENSP00000480853	0.562	Vacuolar protein sorting-associated protein 29
16	9606.ENSP00000360268	0.546	Delta-1-pyrroline-5-carboxylate synthase
17	9606.ENSP00000273258	0.543	PRA1 family protein 3
18	9606.ENSP00000449535	0.534	Acyl-CoA synthetase short-chain family member 3, mitochondrial
19	9606.ENSP00000377233	0.520	Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
20	9606.ENSP00000230085	0.508	Sorting nexin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0051641	0.983	cellular localization
GO:0099177	0.967	regulation of trans-synaptic signaling
GO:0051234	0.960	establishment of localization
GO:0006810	0.944	transport
GO:0048167	0.929	regulation of synaptic plasticity
GO:0046907	0.873	intracellular transport
GO:0048523	0.868	negative regulation of cellular process
GO:0033036	0.864	macromolecule localization
GO:0008104	0.753	protein localization
GO:0071702	0.605	organic substance transport
GO:0071705	0.561	nitrogen compound transport
GO:0015031	0.519	protein transport
GO:0006886	0.389	intracellular protein transport
GO:0071840	0.346	cellular component organization or biogenesis
GO:0032501	0.309	multicellular organismal process
GO:0016043	0.308	cellular component organization
GO:0050896	0.304	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.985	membrane
GO:0005829	0.973	cytosol
GO:0012505	0.972	endomembrane system
GO:0031982	0.858	vesicle
GO:0031410	0.846	cytoplasmic vesicle
GO:0005768	0.635	endosome
GO:0005886	0.549	plasma membrane
GO:0031090	0.509	organelle membrane
GO:0030659	0.451	cytoplasmic vesicle membrane
GO:0005769	0.345	early endosome
GO:0098588	0.343	bounding membrane of organelle
GO:0010008	0.333	endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]