StarFunc result for job id Q96PQ5

User Input

>input (205 residues)
MAASTASQRPLKGILKDNTSTTSSMVASAEHPRGSVHEQLSKKSQKWDEMNILATYRPAD
KDYGLMKIDEPSTPYHSTMGDDEDACSDTETTEAMATDSLAKNLAAAEGLEPKYQVQEQE
SSGEEDSDLSPEEREKKRQFEMRRTLHYNEGLNIKLARQLISKDLHDDDKVEEMLETAHG
ESMNTEESNQGSTASDQQQNKSRSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11845	0.588	0.588	2.944E-23	205	0.844	0.844	P11845.pdb.gz	IPP2_RABIT Protein phosphatase inhibitor 2 OS=Oryctolagus cuniculus OX=9986 GN=PPP1R2 PE=1 SV=3
2	AFDB:Q9DCL8	0.213	0.212	8.579E-19	206	0.771	0.767	Q9DCL8.pdb.gz	IPP2_MOUSE Protein phosphatase inhibitor 2 OS=Mus musculus OX=10090 GN=Ppp1r2 PE=1 SV=3
3	AFDB:O14990	0.455	0.461	1.271E-8	202	0.395	0.401	O14990.pdb.gz	IPP2C_HUMAN Protein phosphatase inhibitor 2 family member C OS=Homo sapiens OX=9606 GN=PPP1R2C PE=1 SV=1
4	AFDB:Q9N537	0.311	0.328	1.492E-6	193	0.278	0.295	Q9N537.pdb.gz	Q9N537_CAEEL Protein phosphatase inhibitor 2 OS=Caenorhabditis elegans OX=6239 GN=szy-2 PE=1 SV=2
5	PDB:2o8aI	0.249	0.835	8.135E-3	59	0.244	0.847	2o8aI.pdb.gz
6	AFDB:A0A1D8PUA3	0.118	0.036	7.495E-2	923	0.141	0.031	A0A1D8PUA3.pdb.gz	A0A1D8PUA3_CANAL Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_CR10800CA PE=3 SV=1
7	AFDB:P29131	0.132	0.094	1.207E-1	319	0.127	0.082	P29131.pdb.gz	FTSN_ECOLI Cell division protein FtsN OS=Escherichia coli (strain K12) OX=83333 GN=ftsN PE=1 SV=3
8	AFDB:Q96IZ7	0.194	0.130	1.585E-1	334	0.141	0.087	Q96IZ7.pdb.gz	RSRC1_HUMAN Serine/Arginine-related protein 53 OS=Homo sapiens OX=9606 GN=RSRC1 PE=1 SV=1
9	AFDB:Q8IQ73	0.146	0.048	1.696E-1	1107	0.180	0.033	Q8IQ73.pdb.gz	Q8IQ73_DROME Cornetto, isoform C OS=Drosophila melanogaster OX=7227 GN=corn PE=4 SV=2
10	AFDB:Q7LFL8	0.171	0.122	2.384E-1	322	0.098	0.062	Q7LFL8.pdb.gz	CXXC5_HUMAN CXXC-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=CXXC5 PE=1 SV=1
11	AFDB:Q9UTP9	0.225	0.076	2.384E-1	735	0.098	0.027	Q9UTP9.pdb.gz	DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dbp4 PE=1 SV=1
12	PDB:5datSM	0.089	0.101	1.886	159	0.141	0.182	5datSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
13	PDB:7ungi	0.124	0.103	2.161	250	0.112	0.092	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
14	PDB:7wtxt	0.109	0.158	3.726	132	0.132	0.205	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
15	PDB:7rroi	0.122	0.105	3.989	235	0.127	0.111	7rroi.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:4v88Ah	0.091	0.108	6.001	159	0.141	0.182	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
17	PDB:5dgeSM	0.090	0.103	6.001	159	0.137	0.176	5dgeSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
18	PDB:5datsM	0.087	0.162	7.879	104	0.117	0.231	5datsM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
19	PDB:7ajtCK	0.116	0.115	7.879	207	0.122	0.121	7ajtCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:7nac7	0.079	0.125	8.434	129	0.073	0.116	7nac7.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P41236	6.09e-127	358	205	0.883	0.883	IPP2_HUMAN Protein phosphatase inhibitor 2 OS=Homo sapiens OX=9606 GN=PPP1R2 PE=1 SV=2
2	Q6NXS1	2.10e-124	351	205	0.878	0.878	IPP2B_HUMAN Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2
3	P11845	3.23e-120	341	205	0.844	0.844	IPP2_RABIT Protein phosphatase inhibitor 2 OS=Oryctolagus cuniculus OX=9986 GN=PPP1R2 PE=1 SV=3
4	P50411	5.73e-110	315	205	0.780	0.780	IPP2_RAT Protein phosphatase inhibitor 2 OS=Rattus norvegicus OX=10116 GN=Ppp1r2 PE=1 SV=2
5	Q9DCL8	4.48e-105	302	206	0.771	0.767	IPP2_MOUSE Protein phosphatase inhibitor 2 OS=Mus musculus OX=10090 GN=Ppp1r2 PE=1 SV=3
6	O14990	3.17e-38	132	202	0.395	0.401	IPP2C_HUMAN Protein phosphatase inhibitor 2 family member C OS=Homo sapiens OX=9606 GN=PPP1R2C PE=1 SV=1
7	Q9V3C7	2.66e-19	84.0	205	0.312	0.312	Q9V3C7_DROME Inhibitor-2 OS=Drosophila melanogaster OX=7227 GN=I-2 PE=1 SV=1
8	Q9N537	2.90e-19	83.6	193	0.259	0.275	Q9N537_CAEEL Protein phosphatase inhibitor 2 OS=Caenorhabditis elegans OX=6239 GN=szy-2 PE=1 SV=2
9	A8JNP7	3.16e-18	82.8	310	0.312	0.206	A8JNP7_DROME Inhibitor-2, isoform B OS=Drosophila melanogaster OX=7227 GN=I-2 PE=1 SV=1
10	C0H480	0.032	35.8	144	0.156	0.222	C0H480_PLAF7 Protein phosphatase inhibitor 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0320000 PE=1 SV=1
11	O27552	0.32	34.3	937	0.141	0.031	SYL_METTH Leucine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=leuS PE=1 SV=1
12	P41818	0.52	33.1	229	0.239	0.214	GLC8_YEAST Protein GLC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLC8 PE=1 SV=1
13	A0A8I6GFN0	1.6	32.0	2477	0.107	0.009	A0A8I6GFN0_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Lrrk2 PE=4 SV=1
14	F1LNJ1	1.6	32.0	2526	0.107	0.009	F1LNJ1_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Lrrk2 PE=1 SV=3
15	Q5S006	1.7	32.0	2527	0.107	0.009	LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Lrrk2 PE=1 SV=2
16	Q17RV3	1.9	32.0	2527	0.107	0.009	Q17RV3_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=LRRK2 PE=2 SV=1
17	Q5S007	2.0	32.0	2527	0.107	0.009	LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=LRRK2 PE=1 SV=2
18	M0QYX3	2.5	30.8	190	0.117	0.126	M0QYX3_HUMAN Interferon regulatory factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=8
19	M0R3C2	2.7	30.8	264	0.112	0.087	M0R3C2_HUMAN Interferon regulatory factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1
20	M0R205	3.4	30.8	287	0.112	0.080	M0R205_HUMAN Interferon regulatory factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04979 IPP-2	3.6e-33	126.6	Protein phosphatase inhibitor 2 (IPP-2)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008958915.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003832521.1	0.832	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
2	9597.XP_003828854.1	0.792	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
3	9597.XP_003813113.1	0.742	Protein phosphatase 1 regulatory subunit 7
4	9597.XP_003829788.1	0.731	Protein phosphatase 1 regulatory inhibitor subunit 11
5	9597.XP_008950752.1	0.712	Belongs to the PPP phosphatase family.
6	9597.XP_003825208.1	0.587	Belongs to the protein kinase superfamily.
7	9597.XP_003807647.1	0.541	Protein phosphatase 1 regulatory subunit 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004864	0.996	protein phosphatase inhibitor activity
GO:0019903	0.965	protein phosphatase binding
GO:0008157	0.964	protein phosphatase 1 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065009	0.978	regulation of molecular function
GO:0006091	0.913	generation of precursor metabolites and energy
GO:0043393	0.853	regulation of protein binding
GO:0035303	0.853	regulation of dephosphorylation
GO:0051172	0.701	negative regulation of nitrogen compound metabolic process
GO:0031399	0.698	regulation of protein modification process
GO:0048523	0.692	negative regulation of cellular process
GO:0010605	0.689	negative regulation of macromolecule metabolic process
GO:0044092	0.619	negative regulation of molecular function
GO:0035304	0.551	regulation of protein dephosphorylation
GO:0043666	0.366	regulation of phosphoprotein phosphatase activity
GO:0031400	0.344	negative regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0032991	0.995	protein-containing complex
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0098794	0.979	postsynapse
GO:0030425	0.978	dendrite
GO:0000164	0.968	protein phosphatase type 1 complex
GO:0043197	0.963	dendritic spine
GO:0043227	0.934	membrane-bounded organelle
GO:0005634	0.856	nucleus
GO:0071944	0.741	cell periphery
GO:0005886	0.734	plasma membrane
GO:0099080	0.718	supramolecular complex
GO:0030424	0.616	axon
GO:0031981	0.507	nuclear lumen
GO:0005654	0.473	nucleoplasm
GO:0005829	0.468	cytosol
GO:0098978	0.409	glutamatergic synapse
GO:0099512	0.380	supramolecular fiber
GO:0098723	0.373	skeletal muscle myofibril
GO:0043025	0.324	neuronal cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]