StarFunc result for job id Q96PQ6

User Input

>input (595 residues)
MAALSPTFATSTQDSTCLQDSEFPVSSKDHSCPQNLDLFVCSGLEPHTPSVGSQESVTFQ
DVAVDFTEKEWPLLDSSQRKLYKDVMLENYSNLTSLGYQVGKPSLISHLEQEEEPRTEER
GAHQGACADWETPSKTKWSLLMEDIFGKETPSGVTMERAGLGEKSTEYAHLFEVFGMDPH
LTQPMGRHAGKRPYHRRDYGVAFKGRPHLTQHMSMYDGRKMHECHQCQKAFTTSASLTRH
RRIHTGEKPYECSDCGKAFNDPSALRSHARTHLKEKPFDCSQCGNAFRTLSALKIHMRVH
TGERPYKCDQCGKAYGRSCHLIAHKRTHTGERPYECHDCGKAFQHPSHLKEHVRNHTGEK
PYACTQCGKAFRWKSNFNLHKKNHMVEKTYECKECGKSFGDLVSRRKHMRIHIVKKPVEC
RQCGKTFRNQSILKTHMNSHTGEKPYGCDLCGKAFSASSNLTAHRKIHTQERRYECAACG
KVFGDYLSRRRHMSVHLVKKRVECRQCGKAFRNQSTLKTHMRSHTGEKPYECDHCGKAFS
IGSNLNVHRRIHTGEKPYECLVCGKAFSDHSSLRSHVKTHRGEKLFVSSVWKRLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96PQ6	1.000	1.000	0.000	595	1.000	1.000	Q96PQ6.pdb.gz	ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens OX=9606 GN=ZNF317 PE=1 SV=2
2	AFDB:Q9P2J8	0.331	0.239	3.698E-51	865	0.415	0.286	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
3	AFDB:P52742	0.326	0.297	3.423E-50	658	0.415	0.375	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
4	AFDB:Q9BX82	0.347	0.332	3.624E-50	626	0.385	0.366	Q9BX82.pdb.gz	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
5	AFDB:A0A024R4S7	0.324	0.256	7.610E-50	792	0.432	0.324	A0A024R4S7.pdb.gz
6	AFDB:Q6ECI4	0.314	0.266	1.072E-49	717	0.395	0.328	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
7	AFDB:P35789	0.339	0.327	1.791E-49	620	0.403	0.387	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
8	AFDB:Q32M78	0.340	0.319	1.896E-49	642	0.425	0.394	Q32M78.pdb.gz	ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens OX=9606 GN=ZNF699 PE=1 SV=1
9	AFDB:P15622	0.335	0.354	2.383E-49	560	0.395	0.420	P15622.pdb.gz	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
10	AFDB:Q9HCL3	0.326	0.360	3.355E-49	533	0.387	0.432	Q9HCL3.pdb.gz	ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens OX=9606 GN=ZFP14 PE=1 SV=2
11	PDB:3w5kB	0.082	0.256	1.234E-4	110	0.062	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5aj0Ap	0.043	0.143	1.431	91	0.029	0.187	5aj0Ap.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
13	PDB:4tn3B	0.048	0.065	1.515	362	0.064	0.105	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
14	PDB:6f40P	0.067	0.085	2.258	246	0.037	0.089	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
15	PDB:6hiwDB	0.078	0.052	2.258	1111	0.092	0.050	6hiwDB.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
16	PDB:6gejS	0.050	0.101	2.531	208	0.052	0.149	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
17	PDB:7mqaNA	0.061	0.103	2.531	295	0.071	0.142	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:5gm6a	0.036	0.128	3.564	123	0.032	0.154	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:5dkaA	0.047	0.204	3.774	96	0.027	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
20	PDB:7ungi	0.047	0.096	3.774	250	0.044	0.104	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96PQ6	0.0	1242	595	1.000	1.000	ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens OX=9606 GN=ZNF317 PE=1 SV=2
2	Q147U1	1.69e-159	469	533	0.430	0.480	ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens OX=9606 GN=ZNF846 PE=1 SV=2
3	Q8TAQ5	4.03e-151	452	688	0.417	0.360	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
4	A0A0U1RQ46	2.13e-149	446	609	0.407	0.397	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
5	Q32M78	5.25e-149	446	642	0.410	0.380	ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens OX=9606 GN=ZNF699 PE=1 SV=1
6	Q9HCL3	8.79e-149	441	533	0.400	0.447	ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens OX=9606 GN=ZFP14 PE=1 SV=2
7	Q9BX82	1.46e-148	444	626	0.403	0.383	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
8	E9QAG8	1.77e-147	437	526	0.402	0.454	ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus OX=10090 GN=Znf431 PE=1 SV=1
9	Q3KP31	2.26e-147	439	576	0.397	0.410	ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens OX=9606 GN=ZNF791 PE=1 SV=1
10	P52742	2.35e-147	442	658	0.430	0.389	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
11	A6NNF4	2.80e-147	440	616	0.408	0.394	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
12	Q8IYB9	6.33e-147	441	648	0.402	0.369	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
13	Q8TD23	7.32e-147	437	568	0.393	0.412	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
14	Q8NEP9	3.22e-146	438	628	0.422	0.400	ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens OX=9606 GN=ZNF555 PE=1 SV=4
15	Q03923	3.73e-146	437	595	0.418	0.418	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
16	Q6ECI4	4.22e-146	441	717	0.430	0.357	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
17	Q5MCW4	1.57e-144	436	686	0.402	0.348	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
18	Q9P2J8	2.02e-144	441	865	0.415	0.286	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
19	P15622	1.10e-143	429	560	0.410	0.436	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
20	Q9BUY5	1.36e-143	429	554	0.400	0.430	ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens OX=9606 GN=ZNF426 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	0.11	24.0	TFIIH C1-like domain
2	PF01363 FYVE	0.19	23.2	FYVE zinc finger
3	PF01155 HypA	0.14	23.6	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
4	PF01352 KRAB	4.8e-21	85.4	KRAB box
5	PF02150 RNA_POL_M_15KD	4.1e+02	12.3	RNA polymerases M/15 Kd subunit
6	PF01286 XPA_N	0.45	21.9	XPA protein N-terminal
7	PF00096 zf-C2H2	3.8e-63	217.7	Zinc finger, C2H2 type
8	PF16622 zf-C2H2_11	2.2e-08	45.0	zinc-finger C2H2-type
9	PF12756 zf-C2H2_2	0.0078	27.9	C2H2 type zinc-finger (2 copies)
10	PF13894 zf-C2H2_4	1.9e-41	148.1	C2H2-type zinc finger
11	PF13912 zf-C2H2_6	2.2e-27	105.7	C2H2-type zinc finger
12	PF12171 zf-C2H2_jaz	4.7e-16	69.8	Zinc-finger double-stranded RNA-binding
13	PF16278 zf-C2HE	0.00045	31.9	C2HE / C2H2 / C2HC zinc-binding finger
14	PF13465 zf-H2C2_2	2.3e-96	323.6	Zinc-finger double domain
15	PF08790 zf-LYAR	16	16.7	LYAR-type C2HC zinc finger
16	PF12874 zf-met	0.00015	33.2	Zinc-finger of C2H2 type
17	PF18439 zf_UBZ	0.81	20.7	Ubiquitin-Binding Zinc Finger
18	PF17032 zinc_ribbon_15	0.0066	28.5	zinc-ribbon family
19	PF09723 Zn-ribbon_8	6.8e-09	47.0	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000247956

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000446099	0.828	RNA binding motif protein, X-linked-like-1
2	9606.ENSP00000333326	0.603	Tubulin alpha-8 chain
3	9606.ENSP00000328848	0.575	RNA-binding protein 10
4	9606.ENSP00000369716	0.569	Chromodomain-helicase-DNA-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0003677	0.481	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0060255	0.998	regulation of macromolecule metabolic process
GO:0048519	0.997	negative regulation of biological process
GO:0009892	0.994	negative regulation of metabolic process
GO:0048523	0.989	negative regulation of cellular process
GO:0051252	0.986	regulation of RNA metabolic process
GO:0010468	0.985	regulation of gene expression
GO:0010605	0.983	negative regulation of macromolecule metabolic process
GO:0051172	0.982	negative regulation of nitrogen compound metabolic process
GO:0006355	0.980	regulation of DNA-templated transcription
GO:0031324	0.979	negative regulation of cellular metabolic process
GO:1902679	0.966	negative regulation of RNA biosynthetic process
GO:0045892	0.964	negative regulation of DNA-templated transcription
GO:0009987	0.667	cellular process
GO:0071704	0.486	organic substance metabolic process
GO:0044238	0.463	primary metabolic process
GO:0006807	0.455	nitrogen compound metabolic process
GO:0043170	0.451	macromolecule metabolic process
GO:0044237	0.416	cellular metabolic process
GO:0034641	0.408	cellular nitrogen compound metabolic process
GO:0006357	0.319	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043233	0.986	organelle lumen
GO:0031981	0.983	nuclear lumen
GO:0005654	0.973	nucleoplasm
GO:0005737	0.731	cytoplasm
GO:0032991	0.413	protein-containing complex
GO:0043228	0.315	non-membrane-bounded organelle
GO:0043232	0.310	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]