StarFunc result for job id Q96PR1

User Input

>input (638 residues)
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPP
LSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRT
GKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPG
DDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFIL
VSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDPALTYVEGVCVVWFTFEFLVR
IVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFK
LTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQ
FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY
SLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSVL
SGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKSRS
LNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14B80	0.865	0.860	1.746E-83	642	0.976	0.970	Q14B80.pdb.gz	KCNC2_MOUSE Potassium voltage-gated channel subfamily C member 2 OS=Mus musculus OX=10090 GN=Kcnc2 PE=1 SV=1
2	AFDB:Q03721	0.670	0.674	7.361E-60	635	0.660	0.663	Q03721.pdb.gz	KCNC4_HUMAN Potassium voltage-gated channel subfamily C member 4 OS=Homo sapiens OX=9606 GN=KCNC4 PE=1 SV=2
3	PDB:7phhA	0.576	0.905	6.683E-43	396	0.539	0.869	7phhA.pdb.gz
4	AFDB:P17972	0.547	0.687	2.019E-39	498	0.382	0.490	P17972.pdb.gz	KCNAW_DROME Potassium voltage-gated channel protein Shaw OS=Drosophila melanogaster OX=7227 GN=Shaw PE=2 SV=1
5	AFDB:G5EEK7	0.551	0.720	1.809E-34	479	0.332	0.443	G5EEK7.pdb.gz	G5EEK7_CAEEL BTB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=shw-3 PE=2 SV=1
6	PDB:7pquA	0.472	0.884	1.462E-30	328	0.458	0.890	7pquA.pdb.gz
7	AFDB:P17970	0.433	0.297	1.929E-28	985	0.306	0.198	P17970.pdb.gz	KCNAB_DROME Potassium voltage-gated channel protein Shab OS=Drosophila melanogaster OX=7227 GN=Shab PE=1 SV=2
8	AFDB:Q8TDN2	0.498	0.576	2.459E-25	545	0.230	0.270	Q8TDN2.pdb.gz	KCNV2_HUMAN Potassium voltage-gated channel subfamily V member 2 OS=Homo sapiens OX=9606 GN=KCNV2 PE=1 SV=1
9	AFDB:Q9UJ96	0.505	0.670	3.214E-24	466	0.235	0.322	Q9UJ96.pdb.gz	KCNG2_HUMAN Potassium voltage-gated channel subfamily G member 2 OS=Homo sapiens OX=9606 GN=KCNG2 PE=1 SV=1
10	PDB:7w6sB	0.470	0.646	2.698E-23	448	0.235	0.335	7w6sB.pdb.gz
11	PDB:7sizB	0.405	0.725	1.750E-22	334	0.246	0.470	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
12	PDB:7f3fA	0.472	0.636	2.665E-22	460	0.232	0.322	7f3fA.pdb.gz
13	PDB:7sszA	0.406	0.674	4.252E-22	362	0.255	0.450	7sszA.pdb.gz
14	PDB:3lutB	0.391	0.601	1.020E-20	390	0.255	0.418	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
15	PDB:2a79B	0.297	0.653	4.855E-14	259	0.194	0.479	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
16	PDB:7bylA	0.292	0.477	2.339E-8	354	0.100	0.181	7bylA.pdb.gz	Structural Basis for the Modulation of Human KCNQ4 by Small-Molecule Drugs.
17	PDB:7vnrA	0.315	0.558	1.448E-7	333	0.107	0.204	7vnrA.pdb.gz	Structural insights into the lipid and ligand regulation of a human neuronal KCNQ channel.
18	AFDB:Q6T3S5	0.233	0.170	6.276E-3	924	0.072	0.050	Q6T3S5.pdb.gz	Q6T3S5_DROME AMO OS=Drosophila melanogaster OX=7227 GN=Pkd2 PE=2 SV=1
19	AFDB:Q75JT4	0.100	0.084	1.326E-2	783	0.074	0.060	Q75JT4.pdb.gz	GRLJ_DICDI Metabotropic glutamate receptor-like protein J OS=Dictyostelium discoideum OX=44689 GN=grlJ PE=2 SV=1
20	AFDB:Q17307	0.090	0.047	2.550E-2	1489	0.088	0.038	Q17307.pdb.gz	TRA2_CAEBR Sex-determining transformer protein 2 OS=Caenorhabditis briggsae OX=6238 GN=tra-2 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E1AZA4	0.0	641	642	0.577	0.573	E1AZA4_DANRE Potassium voltage-gated channel subfamily C member 3 isoform X3 OS=Danio rerio OX=7955 GN=kcnc3a PE=2 SV=1
2	E1AZA5	0.0	695	659	0.629	0.608	E1AZA5_DANRE Potassium voltage-gated channel subfamily C member 3 OS=Danio rerio OX=7955 GN=kcnc3a PE=2 SV=1
3	P15388	0.0	696	511	0.610	0.761	KCNC1_MOUSE Potassium voltage-gated channel subfamily C member 1 OS=Mus musculus OX=10090 GN=Kcnc1 PE=1 SV=1
4	P22462	0.0	1279	638	0.976	0.976	KCNC2_RAT Potassium voltage-gated channel subfamily C member 2 OS=Rattus norvegicus OX=10116 GN=Kcnc2 PE=1 SV=1
5	P25122	0.0	727	585	0.647	0.706	KCNC1_RAT Potassium voltage-gated channel subfamily C member 1 OS=Rattus norvegicus OX=10116 GN=Kcnc1 PE=1 SV=1
6	P48547	0.0	695	511	0.608	0.759	KCNC1_HUMAN Potassium voltage-gated channel subfamily C member 1 OS=Homo sapiens OX=9606 GN=KCNC1 PE=1 SV=1
7	Q01956	0.0	629	889	0.556	0.399	KCNC3_RAT Potassium voltage-gated channel subfamily C member 3 OS=Rattus norvegicus OX=10116 GN=Kcnc3 PE=1 SV=1
8	Q03721	0.0	728	635	0.650	0.654	KCNC4_HUMAN Potassium voltage-gated channel subfamily C member 4 OS=Homo sapiens OX=9606 GN=KCNC4 PE=1 SV=2
9	Q14003	0.0	618	757	0.555	0.468	KCNC3_HUMAN Potassium voltage-gated channel subfamily C member 3 OS=Homo sapiens OX=9606 GN=KCNC3 PE=1 SV=3
10	Q14B80	0.0	1271	642	0.978	0.972	KCNC2_MOUSE Potassium voltage-gated channel subfamily C member 2 OS=Mus musculus OX=10090 GN=Kcnc2 PE=1 SV=1
11	Q63734	0.0	717	625	0.647	0.661	KCNC4_RAT Potassium voltage-gated channel subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Kcnc4 PE=1 SV=1
12	Q63959	0.0	626	769	0.555	0.460	KCNC3_MOUSE Potassium voltage-gated channel subfamily C member 3 OS=Mus musculus OX=10090 GN=Kcnc3 PE=1 SV=3
13	Q8R1C0	0.0	720	628	0.650	0.661	KCNC4_MOUSE Potassium voltage-gated channel subfamily C member 4 OS=Mus musculus OX=10090 GN=Kcnc4 PE=2 SV=1
14	Q96PR1	0.0	1310	638	1.000	1.000	KCNC2_HUMAN Potassium voltage-gated channel subfamily C member 2 OS=Homo sapiens OX=9606 GN=KCNC2 PE=1 SV=1
15	P17972	2.45e-148	440	498	0.373	0.478	KCNAW_DROME Potassium voltage-gated channel protein Shaw OS=Drosophila melanogaster OX=7227 GN=Shaw PE=2 SV=1
16	G5EFC3	1.95e-136	412	558	0.350	0.400	KCNAG_CAEEL Potassium voltage-gated channel protein egl-36 OS=Caenorhabditis elegans OX=6239 GN=egl-36 PE=1 SV=1
17	G5EEK7	7.40e-123	374	479	0.340	0.453	G5EEK7_CAEEL BTB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=shw-3 PE=2 SV=1
18	A0A2R8Q685	2.80e-94	310	834	0.284	0.217	A0A2R8Q685_DANRE Potassium voltage-gated channel subfamily B member 1 OS=Danio rerio OX=7955 GN=kcnb1 PE=3 SV=1
19	Q03717	4.93e-94	310	857	0.285	0.212	KCNB1_MOUSE Potassium voltage-gated channel subfamily B member 1 OS=Mus musculus OX=10090 GN=Kcnb1 PE=1 SV=2
20	Q14721	6.06e-94	310	858	0.285	0.212	KCNB1_HUMAN Potassium voltage-gated channel subfamily B member 1 OS=Homo sapiens OX=9606 GN=KCNB1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02214 BTB_2	9.6e-20	82.1	BTB/POZ domain
2	PF16017 BTB_3	64	14.9	BTB/POZ domain
3	PF00520 Ion_trans	1.5e-40	150.5	Ion transport protein
4	PF07885 Ion_trans_2	7.2e-08	43.6	Ion channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000005549

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004778	0.696	Potassium voltage-gated channel, shaker-related subfamily, beta member 1
2	61853.ENSNLEP00000012563	0.696	Potassium voltage-gated channel, shaker-related subfamily, beta member 2
3	61853.ENSNLEP00000014555	0.691	Zinc finger protein 426
4	61853.ENSNLEP00000011929	0.684	Potassium voltage-gated channel, shaker-related subfamily, beta member 3
5	61853.ENSNLEP00000022620	0.670	40S ribosomal protein S30
6	61853.ENSNLEP00000004391	0.648	Potassium voltage-gated channel, shaker-related subfamily, member 2
7	61853.ENSNLEP00000013465	0.646	Potassium voltage-gated channel, subfamily G, member 4
8	61853.ENSNLEP00000021710	0.643	Potassium voltage-gated channel, shaker-related subfamily, member 4
9	61853.ENSNLEP00000020230	0.624	Potassium voltage-gated channel, subfamily G, member 3
10	61853.ENSNLEP00000001374	0.608	Potassium voltage-gated channel, KQT-like subfamily, member 5
11	61853.ENSNLEP00000012062	0.608	Belongs to the protein kinase superfamily.
12	61853.ENSNLEP00000016255	0.607	Protein kinase, cAMP-dependent, catalytic, alpha
13	61853.ENSNLEP00000022702	0.603	Potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
14	61853.ENSNLEP00000012259	0.598	Potassium voltage-gated channel, KQT-like subfamily, member 2
15	61853.ENSNLEP00000022134	0.598	Potassium voltage-gated channel, shaker-related subfamily, member 3
16	61853.ENSNLEP00000023684	0.595	Uncharacterized protein
17	61853.ENSNLEP00000023968	0.584	Potassium voltage-gated channel, subfamily G, member 1
18	61853.ENSNLEP00000014828	0.580	Potassium voltage-gated channel, KQT-like subfamily, member 4
19	61853.ENSNLEP00000006962	0.576	Potassium voltage-gated channel, KQT-like subfamily, member 3
20	61853.ENSNLEP00000008127	0.576	Potassium voltage-gated channel, delayed-rectifier, subfamily S, member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	1.000	transmembrane transporter binding
GO:0005249	1.000	voltage-gated potassium channel activity
GO:0005251	0.832	delayed rectifier potassium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0006811	0.984	monoatomic ion transport
GO:0065007	0.963	biological regulation
GO:0006813	0.955	potassium ion transport
GO:0032501	0.679	multicellular organismal process
GO:0050789	0.669	regulation of biological process
GO:0032502	0.633	developmental process
GO:0048856	0.597	anatomical structure development
GO:0050794	0.551	regulation of cellular process
GO:0055085	0.508	transmembrane transport
GO:0065008	0.470	regulation of biological quality
GO:0098660	0.453	inorganic ion transmembrane transport
GO:0050896	0.364	response to stimulus
GO:0034220	0.364	monoatomic ion transmembrane transport
GO:0042391	0.338	regulation of membrane potential
GO:0007275	0.330	multicellular organism development
GO:0007154	0.321	cell communication
GO:0071805	0.300	potassium ion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.974	protein-containing complex
GO:0120025	0.948	plasma membrane bounded cell projection
GO:0005622	0.936	intracellular anatomical structure
GO:0030054	0.928	cell junction
GO:0098590	0.925	plasma membrane region
GO:0045202	0.920	synapse
GO:0044297	0.917	cell body
GO:0005737	0.901	cytoplasm
GO:0043005	0.901	neuron projection
GO:0036477	0.898	somatodendritic compartment
GO:0043025	0.892	neuronal cell body
GO:0043226	0.882	organelle
GO:0098793	0.861	presynapse
GO:0097060	0.855	synaptic membrane
GO:0097447	0.851	dendritic tree
GO:0044298	0.837	cell body membrane
GO:0030425	0.832	dendrite
GO:0032809	0.827	neuronal cell body membrane
GO:0098796	0.819	membrane protein complex
GO:0034702	0.808	ion channel complex
GO:0098797	0.742	plasma membrane protein complex
GO:0043227	0.716	membrane-bounded organelle
GO:0034703	0.712	cation channel complex
GO:0008076	0.677	voltage-gated potassium channel complex
GO:0043229	0.536	intracellular organelle
GO:0031982	0.518	vesicle
GO:0043231	0.468	intracellular membrane-bounded organelle
GO:0030424	0.452	axon
GO:0098794	0.320	postsynapse
GO:0031252	0.313	cell leading edge
GO:0042734	0.310	presynaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]