StarFunc result for job id Q96PT4

User Input

>input (197 residues)
MPAEVHGSPPASLCPCPSVKFRPGLPAMALLTALDDTLPEEAQGPGRRMILLSTPSQSDA
LRACFERNLYPGIATKEQLAQGIDIPEPRVQIWFQNERSCQLRQHRRQSRPWPGRRDPQK
GRRKRTAITGSQTALLLRAFEKDRFPGIPAREELARETGLPESRIQLWFQNRRARHWGQS
GRAPTQASIRCNAAPIG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43812	0.746	0.860	1.495E-26	170	0.843	0.976	O43812.pdb.gz	DUX1_HUMAN Double homeobox protein 1 OS=Homo sapiens OX=9606 GN=DUX1 PE=1 SV=1
2	AFDB:C3U3A0	0.621	0.302	6.215E-20	424	0.695	0.323	C3U3A0.pdb.gz	C3U3A0_HUMAN DUX4 OS=Homo sapiens OX=9606 GN=DUX4 PE=2 SV=1
3	AFDB:A6NLW8	0.546	0.530	2.474E-10	204	0.335	0.324	A6NLW8.pdb.gz	DUXA_HUMAN Double homeobox protein A OS=Homo sapiens OX=9606 GN=DUXA PE=2 SV=1
4	AFDB:Q7TNE6	0.304	0.176	1.121E-9	350	0.330	0.186	Q7TNE6.pdb.gz	Q7TNE6_MOUSE Double homeobox B-like OS=Mus musculus OX=10090 GN=Duxbl1 PE=1 SV=1
5	AFDB:Q3UY88	0.329	0.323	1.082E-8	201	0.289	0.284	Q3UY88.pdb.gz	Q3UY88_MOUSE Double homeobox B-like 1 OS=Mus musculus OX=10090 GN=Duxbl1 PE=2 SV=1
6	AFDB:A0A024R9F1	0.305	0.080	8.889E-7	873	0.178	0.040	A0A024R9F1.pdb.gz
7	AFDB:Q9H4I2	0.299	0.069	3.336E-6	956	0.208	0.043	Q9H4I2.pdb.gz	ZHX3_HUMAN Zinc fingers and homeoboxes protein 3 OS=Homo sapiens OX=9606 GN=ZHX3 PE=1 SV=3
8	AFDB:Q80Z36	0.293	0.079	4.292E-6	951	0.203	0.042	Q80Z36.pdb.gz	ZHX3_RAT Zinc fingers and homeoboxes protein 3 OS=Rattus norvegicus OX=10116 GN=Zhx3 PE=1 SV=2
9	AFDB:Q9Y6X8	0.273	0.070	7.103E-6	837	0.223	0.053	Q9Y6X8.pdb.gz	ZHX2_HUMAN Zinc fingers and homeoboxes protein 2 OS=Homo sapiens OX=9606 GN=ZHX2 PE=1 SV=1
10	AFDB:Q8C0C0	0.281	0.073	1.715E-5	836	0.228	0.054	Q8C0C0.pdb.gz	ZHX2_MOUSE Zinc fingers and homeoboxes protein 2 OS=Mus musculus OX=10090 GN=Zhx2 PE=1 SV=1
11	PDB:4egcA	0.242	0.089	6.196E-3	539	0.117	0.043	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.240	0.588	6.783E-2	73	0.102	0.274	2hi3A.pdb.gz
13	PDB:5lzbz	0.171	0.069	1.538E-1	614	0.117	0.037	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
14	PDB:7fbyA	0.188	0.233	2.244E-1	153	0.081	0.105	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:6qdvO	0.166	0.083	5.089E-1	441	0.168	0.075	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
16	PDB:7vdvX	0.176	0.141	5.772E-1	252	0.127	0.099	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
17	PDB:5mymC	0.155	0.152	6.148E-1	205	0.127	0.122	5mymC.pdb.gz	Target Identification of Mycobacterium tuberculosis Phenotypic Hits Using a Concerted Chemogenomic, Biophysical, and Structural Approach.
18	PDB:1jeqA	0.137	0.060	8.423E-1	548	0.107	0.038	1jeqA.pdb.gz
19	PDB:6jcxF	0.161	0.170	8.423E-1	186	0.112	0.118	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
20	PDB:5yzgL	0.202	0.099	8.970E-1	419	0.147	0.069	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43812	1.25e-117	332	170	0.843	0.976	DUX1_HUMAN Double homeobox protein 1 OS=Homo sapiens OX=9606 GN=DUX1 PE=1 SV=1
2	Q6RFH8	1.07e-84	256	374	0.695	0.366	DUX4C_HUMAN Double homeobox protein 4C OS=Homo sapiens OX=9606 GN=DUX4L9 PE=1 SV=1
3	C3U3A0	6.18e-84	256	424	0.695	0.323	C3U3A0_HUMAN DUX4 OS=Homo sapiens OX=9606 GN=DUX4 PE=2 SV=1
4	Q9UBX2	6.18e-84	256	424	0.695	0.323	DUX4_HUMAN Double homeobox protein 4 OS=Homo sapiens OX=9606 GN=DUX4 PE=1 SV=2
5	L7MUF5	7.30e-32	115	189	0.355	0.370	L7MUF5_MOUSE Double homeobox B-like 1 (Fragment) OS=Mus musculus OX=10090 GN=Duxbl1 PE=4 SV=1
6	Q7TNE6	4.77e-30	115	350	0.325	0.183	Q7TNE6_MOUSE Double homeobox B-like OS=Mus musculus OX=10090 GN=Duxbl1 PE=1 SV=1
7	A6NLW8	2.24e-27	104	204	0.310	0.299	DUXA_HUMAN Double homeobox protein A OS=Homo sapiens OX=9606 GN=DUXA PE=2 SV=1
8	Q3UY88	1.77e-23	94.4	201	0.284	0.279	Q3UY88_MOUSE Double homeobox B-like 1 OS=Mus musculus OX=10090 GN=Duxbl1 PE=2 SV=1
9	Q1RM27	6.01e-15	73.6	296	0.173	0.115	Q1RM27_DANRE Mix-type homeobox gene 2 OS=Danio rerio OX=7955 GN=mtx2 PE=2 SV=1
10	A0JPE5	4.50e-14	71.2	309	0.168	0.107	A0JPE5_DANRE Mix-type homeobox gene 1 OS=Danio rerio OX=7955 GN=mtx1 PE=2 SV=1
11	O42357	1.22e-13	70.1	327	0.178	0.107	RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1
12	O42356	3.70e-13	68.9	330	0.162	0.097	RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2
13	Q91898	8.29e-13	65.9	187	0.157	0.166	HESXB_XENLA Homeobox expressed in ES cells 1-B OS=Xenopus laevis OX=8355 GN=hesx1-b PE=1 SV=2
14	P21711	1.48e-12	67.4	377	0.168	0.088	MIX1_XENLA Homeobox protein Mix.1 OS=Xenopus laevis OX=8355 GN=mix-a PE=2 SV=2
15	O42358	1.59e-12	66.6	292	0.157	0.106	RX3_DANRE Retinal homeobox protein Rx3 OS=Danio rerio OX=7955 GN=rx3 PE=2 SV=1
16	P80205	2.12e-12	66.6	355	0.183	0.101	OTX1_MOUSE Homeobox protein OTX1 OS=Mus musculus OX=10090 GN=Otx1 PE=2 SV=1
17	L8E946	2.99e-12	65.9	279	0.162	0.115	UNC42_CAEEL Homeobox protein unc-42 OS=Caenorhabditis elegans OX=6239 GN=unc-42 PE=1 SV=1
18	P79738	3.24e-12	63.9	161	0.147	0.180	P79738_DANRE Homeobox expressed in ES cells 1 OS=Danio rerio OX=7955 GN=DANF PE=2 SV=1
19	Q9H2W2	3.31e-12	65.1	232	0.173	0.147	MIXL1_HUMAN Homeobox protein MIXL1 OS=Homo sapiens OX=9606 GN=MIXL1 PE=1 SV=1
20	Q9PT61	4.51e-12	65.5	290	0.152	0.103	OTX5B_XENLA Homeobox protein otx5-B OS=Xenopus laevis OX=8355 GN=otx5-b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04218 CENP-B_N	78	14.3	CENP-B N-terminal DNA-binding domain
2	PF05920 Homeobox_KN	1.7e-05	36.0	Homeobox KN domain
3	PF00046 Homeodomain	1.9e-28	109.4	Homeodomain
4	PF13443 HTH_26	13	17.7	Cro/C1-type HTH DNA-binding domain
5	PF01381 HTH_3	4e+02	12.5	Helix-turn-helix
6	PF01361 Tautomerase	4.2e+02	12.3	Tautomerase enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000022183

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000004075	0.547	Belongs to the syndecan proteoglycan family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0000981	0.998	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.990	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.984	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.965	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0010468	0.798	regulation of gene expression
GO:0006355	0.715	regulation of DNA-templated transcription
GO:0006357	0.546	regulation of transcription by RNA polymerase II
GO:0048518	0.544	positive regulation of biological process
GO:0048522	0.509	positive regulation of cellular process
GO:0009893	0.405	positive regulation of metabolic process
GO:0045935	0.391	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.388	positive regulation of biosynthetic process
GO:0045893	0.378	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]