StarFunc result for job id Q96PU4

User Input

>input (802 residues)
MWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFD
YDVGLNDIIQLLVRPDPDHLPGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLI
DPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH
KSKENTNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRARTILKWN
ELNVGDVVMVNYNVESPGQRGFWFDAEITTLKTISRTKKELRVKIFLGGSEGTLNDCKII
SVDEIFKIERPGAHPLSFADGKFLRRNDPECDLCGGDPEKKCHSCSCRVCGGKHEPNMQL
LCDECNVAYHIYCLNPPLDKVPEEEYWYCPSCKTDSSEVVKAGERLKMSKKKAKMPSAST
ESRRDWGRGMACVGRTRECTIVPSNHYGPIPGIPVGSTWRFRVQVSEAGVHRPHVGGIHG
RSNDGAYSLVLAGGFADEVDRGDEFTYTGSGGKNLAGNKRIGAPSADQTLTNMNRALALN
CDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYKVVKYWPEISSS
HGFLVWRYLLRRDDVEPAPWTSEGIERSRRLCLRLQYPAGYPSDKEGKKPKGQSKKQPSG
TTKRPISDDDCPSASKVYKASDSAEAIEAFQLTPQQQHLIREDCQNQKLWDEVLSHLVEG
PNFLKKLEQSFMCVCCQELVYQPVTTECFHNVCKDCLQRSFKAQVFSCPACRHDLGQNYI
MIPNEILQTLLDLFFPGYSKGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TMI3	0.872	0.871	0.000	803	0.908	0.907	Q7TMI3.pdb.gz	UHRF2_MOUSE E3 ubiquitin-protein ligase UHRF2 OS=Mus musculus OX=10090 GN=Uhrf2 PE=1 SV=1
2	AFDB:A0A087WTW0	0.457	0.430	3.952E-102	857	0.551	0.516	A0A087WTW0.pdb.gz	A0A087WTW0_HUMAN E3 ubiquitin-protein ligase UHRF OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1
3	AFDB:E7EZF3	0.473	0.487	1.565E-101	776	0.541	0.559	E7EZF3.pdb.gz	UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio OX=7955 GN=uhrf1 PE=1 SV=1
4	AFDB:Q8VDF2	0.519	0.530	3.547E-96	782	0.522	0.536	Q8VDF2.pdb.gz	UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus OX=10090 GN=Uhrf1 PE=1 SV=2
5	AFDB:Q8VYZ0	0.205	0.253	1.858E-25	645	0.181	0.225	Q8VYZ0.pdb.gz	ORTH2_ARATH E3 ubiquitin-protein ligase ORTHRUS 2 OS=Arabidopsis thaliana OX=3702 GN=ORTH2 PE=1 SV=1
6	AFDB:Q680I0	0.219	0.279	3.222E-25	623	0.177	0.228	Q680I0.pdb.gz	ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana OX=3702 GN=ORTH5 PE=2 SV=1
7	AFDB:J9VHE9	0.215	0.482	1.115E-15	342	0.102	0.240	J9VHE9.pdb.gz	UHRF1_CRYNH UHRF1-like protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=UHF1 PE=3 SV=2
8	AFDB:P15357	0.090	0.450	7.332E-8	156	0.049	0.250	P15357.pdb.gz	RS27A_DROME Ubiquitin-ribosomal protein eS31 fusion protein OS=Drosophila melanogaster OX=7227 GN=RpS27A PE=1 SV=2
9	AFDB:P59232	0.092	0.458	8.648E-8	157	0.041	0.210	P59232.pdb.gz	R27AB_ARATH Ubiquitin-ribosomal protein eS31y fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPS27AB PE=2 SV=2
10	AFDB:P49632	0.096	0.577	2.330E-7	128	0.036	0.227	P49632.pdb.gz	RL40_CAEEL Ubiquitin-ribosomal protein eL40 fusion protein OS=Caenorhabditis elegans OX=6239 GN=ubq-2 PE=3 SV=2
11	PDB:6ef3u	0.088	0.858	5.046E-6	75	0.034	0.360	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
12	PDB:3dbhI	0.088	0.758	7.418E-6	86	0.032	0.302	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
13	PDB:3ai5A	0.088	0.232	2.780E-5	299	0.035	0.094	3ai5A.pdb.gz
14	PDB:7rbsB	0.091	0.448	4.563E-5	157	0.025	0.127	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
15	PDB:6mdhA	0.089	0.465	1.710E-4	149	0.021	0.114	6mdhA.pdb.gz
16	PDB:6yvaC	0.093	0.462	1.909E-4	155	0.021	0.110	6yvaC.pdb.gz
17	PDB:4pyuA	0.088	0.868	2.514E-4	76	0.015	0.158	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
18	PDB:3plvA	0.088	0.835	4.360E-4	80	0.015	0.150	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
19	PDB:4zynB	0.091	0.187	7.561E-4	385	0.026	0.055	4zynB.pdb.gz	A Ubl/ubiquitin switch in the activation of Parkin.
20	PDB:4x57B	0.085	0.643	7.989E-4	93	0.026	0.226	4x57B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WTW0	0.0	869	857	0.557	0.522	A0A087WTW0_HUMAN E3 ubiquitin-protein ligase UHRF OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1
2	A0A087WVR3	0.0	869	806	0.557	0.555	A0A087WVR3_HUMAN E3 ubiquitin-protein ligase UHRF OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1
3	E7EZF3	0.0	863	776	0.550	0.568	UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio OX=7955 GN=uhrf1 PE=1 SV=1
4	Q7TMI3	0.0	1521	803	0.909	0.908	UHRF2_MOUSE E3 ubiquitin-protein ligase UHRF2 OS=Mus musculus OX=10090 GN=Uhrf2 PE=1 SV=1
5	Q7TPK1	0.0	807	774	0.541	0.561	UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus OX=10116 GN=Uhrf1 PE=1 SV=2
6	Q8VDF2	0.0	803	782	0.537	0.551	UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus OX=10090 GN=Uhrf1 PE=1 SV=2
7	Q96PU4	0.0	1669	802	1.000	1.000	UHRF2_HUMAN E3 ubiquitin-protein ligase UHRF2 OS=Homo sapiens OX=9606 GN=UHRF2 PE=1 SV=1
8	Q96T88	0.0	869	793	0.557	0.564	UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1
9	Q9FKA7	1.30e-47	181	617	0.156	0.203	ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana OX=3702 GN=ORTH1 PE=1 SV=1
10	Q680I0	1.98e-46	177	623	0.158	0.204	ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana OX=3702 GN=ORTH5 PE=2 SV=1
11	Q8VYZ0	1.30e-45	176	645	0.155	0.192	ORTH2_ARATH E3 ubiquitin-protein ligase ORTHRUS 2 OS=Arabidopsis thaliana OX=3702 GN=ORTH2 PE=1 SV=1
12	Q681I0	1.96e-33	137	465	0.130	0.224	ORTHL_ARATH E3 ubiquitin-protein ligase ORTHRUS-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=ORTHL PE=2 SV=1
13	J9VHE9	1.13e-30	125	342	0.097	0.228	UHRF1_CRYNH UHRF1-like protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=UHF1 PE=3 SV=2
14	O82175	7.53e-21	100	794	0.080	0.081	SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 OS=Arabidopsis thaliana OX=3702 GN=SUVH5 PE=1 SV=1
15	Q8VZ17	1.10e-16	87.0	790	0.075	0.076	SUVH6_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 OS=Arabidopsis thaliana OX=3702 GN=SUVH6 PE=1 SV=2
16	Q8GZB6	6.39e-16	84.3	624	0.077	0.099	SUVH4_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 OS=Arabidopsis thaliana OX=3702 GN=SUVH4 PE=1 SV=2
17	Q9T0G7	2.14e-12	73.2	650	0.079	0.097	SUVH9_ARATH Histone-lysine N-methyltransferase family member SUVH9 OS=Arabidopsis thaliana OX=3702 GN=SUVH9 PE=1 SV=1
18	O22781	8.06e-11	68.2	651	0.089	0.109	SUVH2_ARATH Histone-lysine N-methyltransferase family member SUVH2 OS=Arabidopsis thaliana OX=3702 GN=SUVH2 PE=1 SV=1
19	Q9SGH2	5.32e-10	65.9	2176	0.035	0.013	MBD9_ARATH Methyl-CpG-binding domain-containing protein 9 OS=Arabidopsis thaliana OX=3702 GN=MBD9 PE=2 SV=1
20	Q9HDV4	2.69e-08	60.1	1513	0.036	0.019	LID2_SCHPO Lid2 complex component lid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lid2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00628 PHD	1.4e-08	45.8	PHD-finger
2	PF13831 PHD_2	23	15.8	PHD-finger
3	PF02182 SAD_SRA	1.1e-47	173.1	SAD/SRA domain
4	PF12148 TTD	1.1e-60	215.5	Tandem tudor domain within UHRF1
5	PF00240 ubiquitin	1.9e-11	54.9	Ubiquitin family
6	PF00097 zf-C3HC4	4	18.7	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	0.21	22.8	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	0.27	22.4	Zinc finger, C3HC4 type (RING finger)
9	PF16685 zf-RING_10	4.5	18.8	zinc RING finger of MSL2
10	PF13639 zf-RING_2	68	15.3	Ring finger domain
11	PF14634 zf-RING_5	25	16.2	zinc-RING finger domain
12	PF13445 zf-RING_UBOX	32	16.0	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276893

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352516	0.994	DNA (cytosine-5)-methyltransferase 1
2	9606.ENSP00000368458	0.969	Proliferating cell nuclear antigen
3	9606.ENSP00000421246	0.935	Zinc finger protein 131
4	9606.ENSP00000348056	0.931	SUMO-conjugating enzyme UBC9
5	9606.ENSP00000376077	0.903	Small ubiquitin-related modifier 1
6	9606.ENSP00000349722	0.876	Ubiquitin conjugating enzyme E2 D3
7	9606.ENSP00000362649	0.858	Histone deacetylase 1
8	9606.ENSP00000367030	0.754	tRNA (cytosine(38)-C(5))-methyltransferase
9	9606.ENSP00000363019	0.743	Ubiquitin-conjugating enzyme E2 D1
10	9606.ENSP00000426387	0.743	Zinc finger and BTB domain-containing protein 38
11	9606.ENSP00000266970	0.732	Cyclin-dependent kinase 2
12	9606.ENSP00000364678	0.718	Histone-lysine N-methyltransferase EHMT2
13	9606.ENSP00000343535	0.717	Ubiquitin carboxyl-terminal hydrolase 7
14	9606.ENSP00000265260	0.675	PEST proteolytic signal-containing nuclear protein
15	9606.ENSP00000216122	0.654	DNA replication licensing factor MCM5
16	9606.ENSP00000265056	0.654	DNA replication licensing factor MCM2
17	9606.ENSP00000306968	0.653	Cell division cycle-associated protein 7
18	9606.ENSP00000307858	0.622	Zinc finger and BTB domain-containing protein 4
19	9606.ENSP00000341657	0.622	Thymocyte nuclear protein 1
20	9606.ENSP00000262315	0.617	Chromosome transmission fidelity protein 18 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	0.999	histone binding
GO:0019787	0.999	ubiquitin-like protein transferase activity
GO:0008134	0.997	transcription factor binding
GO:0004842	0.993	ubiquitin-protein transferase activity
GO:0061630	0.983	ubiquitin protein ligase activity
GO:0003676	0.947	nucleic acid binding
GO:0003677	0.921	DNA binding
GO:0003690	0.872	double-stranded DNA binding
GO:0140297	0.796	DNA-binding transcription factor binding
GO:0019789	0.709	SUMO transferase activity
GO:0061629	0.704	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140030	0.683	modification-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0009987	0.991	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0043170	0.983	macromolecule metabolic process
GO:0043412	0.948	macromolecule modification
GO:1901564	0.937	organonitrogen compound metabolic process
GO:0036211	0.925	protein modification process
GO:0016567	0.890	protein ubiquitination
GO:0051865	0.751	protein autoubiquitination
GO:0060255	0.713	regulation of macromolecule metabolic process
GO:0044237	0.706	cellular metabolic process
GO:0048519	0.630	negative regulation of biological process
GO:0010468	0.623	regulation of gene expression
GO:0034641	0.614	cellular nitrogen compound metabolic process
GO:0044260	0.604	cellular macromolecule metabolic process
GO:0032502	0.585	developmental process
GO:0006725	0.576	cellular aromatic compound metabolic process
GO:0010605	0.576	negative regulation of macromolecule metabolic process
GO:1901360	0.575	organic cyclic compound metabolic process
GO:0006139	0.574	nucleobase-containing compound metabolic process
GO:0071840	0.566	cellular component organization or biogenesis
GO:0090304	0.554	nucleic acid metabolic process
GO:0016043	0.548	cellular component organization
GO:0080090	0.483	regulation of primary metabolic process
GO:0051171	0.483	regulation of nitrogen compound metabolic process
GO:0031323	0.480	regulation of cellular metabolic process
GO:0050896	0.464	response to stimulus
GO:0019219	0.443	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.363	regulation of cellular biosynthetic process
GO:0006259	0.362	DNA metabolic process
GO:0048523	0.360	negative regulation of cellular process
GO:0010556	0.355	regulation of macromolecule biosynthetic process
GO:0051252	0.348	regulation of RNA metabolic process
GO:0048518	0.345	positive regulation of biological process
GO:0051172	0.335	negative regulation of nitrogen compound metabolic process
GO:2001141	0.334	regulation of RNA biosynthetic process
GO:0016925	0.316	protein sumoylation
GO:0031324	0.314	negative regulation of cellular metabolic process
GO:1903506	0.307	regulation of nucleic acid-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000785	0.998	chromatin
GO:0031981	0.998	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0000792	0.983	heterochromatin
GO:0005737	0.734	cytoplasm
GO:0032991	0.703	protein-containing complex
GO:0098687	0.341	chromosomal region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]