StarFunc result for job id Q96PU5

User Input

>input (975 residues)
MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELAL
VQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDP
TMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSN
DSASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDVSSESDNNIRQI
NQEAAHRRFRSRRHISEDLEPEPSEGGDVPEPWETISEEVNIAGDSLGLALPPPPASPGS
RTSPQELSEELSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDAVAEQGHLPPPSAPA
GRARSSTVTGGEEPTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQL
AEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSP
QPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSKT
SLNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQK
YDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDY
GGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLA
VFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEE
NFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLI
KIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQ
FVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREK
LLMAVENAQGFEGVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CFI0	0.298	0.291	0.000	1004	0.966	0.938	Q8CFI0.pdb.gz	NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus OX=10090 GN=Nedd4l PE=1 SV=2
2	AFDB:Q9VVI3	0.449	0.435	2.102E-100	1007	0.487	0.472	Q9VVI3.pdb.gz	NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster OX=7227 GN=Nedd4 PE=1 SV=2
3	AFDB:P46934	0.287	0.215	9.426E-96	1319	0.554	0.409	P46934.pdb.gz	NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens OX=9606 GN=NEDD4 PE=1 SV=4
4	AFDB:A2A5Z6	0.361	0.458	9.501E-68	748	0.324	0.422	A2A5Z6.pdb.gz	SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus OX=10090 GN=Smurf2 PE=1 SV=1
5	AFDB:Q9P2P5	0.404	0.259	9.031E-58	1572	0.330	0.205	Q9P2P5.pdb.gz	HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens OX=9606 GN=HECW2 PE=1 SV=2
6	AFDB:Q9UTG2	0.414	0.589	3.270E-52	671	0.242	0.352	Q9UTG2.pdb.gz	PUB2_SCHPO E3 ubiquitin-protein ligase pub2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub2 PE=1 SV=1
7	AFDB:F8W2M1	0.259	0.278	5.037E-39	904	0.163	0.176	F8W2M1.pdb.gz	HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio OX=7955 GN=hace1 PE=3 SV=2
8	AFDB:Q8IYU2	0.258	0.276	5.917E-38	909	0.166	0.178	Q8IYU2.pdb.gz	HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens OX=9606 GN=HACE1 PE=1 SV=2
9	PDB:7jq9A	0.254	0.106	1.287E-35	2427	0.178	0.072	7jq9A.pdb.gz
10	PDB:7mopA	0.246	0.102	1.287E-35	2445	0.178	0.071	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
11	AFDB:Q8IVU3	0.337	0.321	1.069E-28	1022	0.107	0.102	Q8IVU3.pdb.gz	HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2
12	AFDB:Q9UII4	0.330	0.315	7.756E-28	1024	0.107	0.102	Q9UII4.pdb.gz	HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens OX=9606 GN=HERC5 PE=1 SV=2
13	PDB:5a50A	0.113	0.577	6.821E-9	165	0.042	0.248	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
14	PDB:5ixcA	0.116	0.164	8.915E-9	684	0.034	0.048	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5iz5B	0.119	0.154	2.466E-8	746	0.035	0.046	5iz5B.pdb.gz
16	PDB:5a52A	0.107	0.596	4.948E-8	154	0.033	0.208	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
17	PDB:4rj9A	0.108	0.559	5.507E-8	161	0.041	0.248	4rj9A.pdb.gz
18	PDB:5izrC	0.114	0.167	1.166E-7	659	0.034	0.050	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
19	PDB:5iz5A	0.113	0.144	1.523E-7	757	0.037	0.048	5iz5A.pdb.gz
20	PDB:1cjyA	0.113	0.170	1.789E-7	633	0.030	0.046	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JUY1	862	921	0.453	0.480	A0A0G2JUY1_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=2
2	A0A8I6A4L5	1982	976	0.979	0.978	A0A8I6A4L5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
3	A0A8I6A6J7	860	921	0.453	0.480	A0A8I6A6J7_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
4	A0A8I6AEH7	984	1071	0.509	0.463	A0A8I6AEH7_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
5	A0A8I6AIV5	1090	872	0.534	0.597	A0A8I6AIV5_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
6	A0A8I6GKS9	862	942	0.453	0.469	A0A8I6GKS9_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
7	A0A8I6GL04	1792	912	0.908	0.970	A0A8I6GL04_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
8	A0A8I6GLU0	1938	956	0.963	0.982	A0A8I6GLU0_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
9	D7NIW0	1952	968	0.966	0.973	D7NIW0_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
10	F1LRN8	860	856	0.453	0.516	F1LRN8_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=4
11	H0VCR8	1848	984	0.949	0.940	H0VCR8_CAVPO HECT-type E3 ubiquitin transferase OS=Cavia porcellus OX=10141 GN=NEDD4L PE=4 SV=2
12	P39940	574	809	0.302	0.363	RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSP5 PE=1 SV=1
13	P46934	1093	1319	0.563	0.416	NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens OX=9606 GN=NEDD4 PE=1 SV=4
14	P46935	1034	887	0.574	0.631	NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus OX=10090 GN=Nedd4 PE=1 SV=3
15	Q3KRP0	1140	910	0.617	0.662	Q3KRP0_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=si:ch211-79l17.5 PE=2 SV=1
16	Q5BDP1	571	821	0.314	0.373	RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=hulA PE=1 SV=1
17	Q5U1Z5	922	440	0.450	0.998	Q5U1Z5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=2 SV=1
18	Q62940	1035	887	0.576	0.634	NEDD4_RAT E3 ubiquitin-protein ligase NEDD4 OS=Rattus norvegicus OX=10116 GN=Nedd4 PE=1 SV=1
19	Q6P778	553	263	0.270	1.000	Q6P778_RAT Nedd4l protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=2 SV=1
20	Q8CFI0	1954	1004	0.966	0.938	NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus OX=10090 GN=Nedd4l PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2.1e-22	90.7	C2 domain
2	PF00632 HECT	2.3e-94	327.9	HECT-domain (ubiquitin-transferase)
3	PF00397 WW	3.4e-45	163.1	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383199

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262158	0.999	Mothers against decapentaplegic homolog 7
2	9606.ENSP00000262160	0.999	Mothers against decapentaplegic homolog 2
3	9606.ENSP00000345751	0.998	Amiloride-sensitive sodium channel subunit beta
4	9606.ENSP00000353292	0.998	Amiloride-sensitive sodium channel subunit alpha
5	9606.ENSP00000356832	0.998	Serine/threonine-protein kinase Sgk1
6	9606.ENSP00000381717	0.997	Ubiquitin-conjugating enzyme E2 D2
7	9606.ENSP00000300061	0.996	Amiloride-sensitive sodium channel subunit gamma
8	9606.ENSP00000332973	0.996	Mothers against decapentaplegic homolog 3
9	9606.ENSP00000441543	0.995	Polyubiquitin-C
10	9606.ENSP00000431418	0.989	High affinity nerve growth factor receptor
11	9606.ENSP00000253814	0.962	NEDD4 family-interacting protein 1
12	9606.ENSP00000400906	0.961	Ubiquitin-conjugating enzyme E2L 3
13	9606.ENSP00000304697	0.958	Polyubiquitin-B
14	9606.ENSP00000361930	0.951	14-3-3 protein beta/alpha
15	9606.ENSP00000363019	0.943	Ubiquitin-conjugating enzyme E2 D1
16	9606.ENSP00000364133	0.939	TGF-beta receptor type-1
17	9606.ENSP00000371341	0.937	Activated CDC42 kinase 1
18	9606.ENSP00000368411	0.935	Amiloride-sensitive sodium channel subunit delta
19	9606.ENSP00000386444	0.919	S-arrestin
20	9606.ENSP00000251968	0.913	Tumor susceptibility gene 101 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061630	0.909	ubiquitin protein ligase activity
GO:0098772	0.306	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0016567	0.995	protein ubiquitination
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0051247	0.982	positive regulation of protein metabolic process
GO:0042176	0.980	regulation of protein catabolic process
GO:0006513	0.977	protein monoubiquitination
GO:0045732	0.952	positive regulation of protein catabolic process
GO:0050794	0.746	regulation of cellular process
GO:0009987	0.726	cellular process
GO:0050896	0.451	response to stimulus
GO:0048519	0.407	negative regulation of biological process
GO:0044237	0.331	cellular metabolic process
GO:0048522	0.329	positive regulation of cellular process
GO:0051179	0.312	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.998	membrane
GO:0031981	0.996	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0005886	0.991	plasma membrane
GO:0031982	0.987	vesicle
GO:0005576	0.984	extracellular region
GO:0005615	0.915	extracellular space
GO:0065010	0.915	extracellular membrane-bounded organelle
GO:0070062	0.904	extracellular exosome
GO:0032991	0.886	protein-containing complex
GO:0012505	0.341	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]