StarFunc result for job id Q96PU8

User Input

>input (341 residues)
MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDT
LNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCK
IMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLV
PAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAA
LRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSI
LEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q32NN2	0.642	0.642	2.626E-44	341	0.933	0.933	Q32NN2.pdb.gz	QKIA_XENLA KH domain-containing RNA-binding protein qki.S OS=Xenopus laevis OX=8355 GN=qki.S PE=1 SV=2
2	AFDB:Q6P104	0.624	0.666	1.710E-42	319	0.839	0.897	Q6P104.pdb.gz	QKIB_DANRE Protein quaking-B OS=Danio rerio OX=7955 GN=qki2 PE=2 SV=1
3	AFDB:Q6P0D0	0.623	0.623	7.443E-42	341	0.798	0.798	Q6P0D0.pdb.gz	QKIA_DANRE Protein quaking-A OS=Danio rerio OX=7955 GN=qkia PE=2 SV=2
4	AFDB:G5EFF1	0.517	0.403	2.618E-23	445	0.408	0.312	G5EFF1.pdb.gz	ASD2_CAEEL RNA-binding protein asd-2 OS=Caenorhabditis elegans OX=6239 GN=asd-2 PE=1 SV=1
5	AFDB:D4YW53	0.537	0.385	1.271E-21	486	0.411	0.288	D4YW53.pdb.gz	D4YW53_CAEEL K Homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=asd-2 PE=1 SV=2
6	AFDB:O75525	0.386	0.381	5.343E-17	346	0.296	0.292	O75525.pdb.gz	KHDR3_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Homo sapiens OX=9606 GN=KHDRBS3 PE=1 SV=1
7	AFDB:Q8UUW7	0.387	0.309	6.010E-17	433	0.337	0.266	Q8UUW7.pdb.gz	KHDR1_CHICK KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Gallus gallus OX=9031 GN=KHDRBS1 PE=2 SV=1
8	AFDB:Q9ZVI3	0.370	0.437	1.020E-16	286	0.249	0.297	Q9ZVI3.pdb.gz	QKIL3_ARATH KH domain-containing protein At2g38610 OS=Arabidopsis thaliana OX=3702 GN=At2g38610 PE=1 SV=1
9	AFDB:Q6NW62	0.385	0.374	2.067E-16	352	0.317	0.307	Q6NW62.pdb.gz	Q6NW62_DANRE KH domain-containing, RNA-binding, signal transduction-associated 1b OS=Danio rerio OX=7955 GN=sb:cb97 PE=1 SV=1
10	AFDB:Q75GR5	0.384	0.461	8.995E-16	281	0.243	0.295	Q75GR5.pdb.gz	SPIN1_ORYSJ KH domain-containing protein SPIN1 OS=Oryza sativa subsp. japonica OX=39947 GN=SPIN1 PE=1 SV=1
11	PDB:6ke6RC	0.168	0.203	9.359E-2	278	0.088	0.108	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
12	PDB:7mqaSW	0.182	0.303	1.184E-1	195	0.047	0.082	7mqaSW.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7mq8NY	0.160	0.193	2.544E-1	274	0.070	0.088	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:6zqbJO	0.169	0.237	3.840E-1	236	0.059	0.085	6zqbJO.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
15	PDB:5adzA	0.082	0.052	2.522	566	0.032	0.019	5adzA.pdb.gz	Discovery of Inhibitors for the Ether Lipid-Generating Enzyme Agps as Anti-Cancer Agents.
16	PDB:7ax1A	0.104	0.076	2.675	518	0.050	0.033	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
17	PDB:3wzfA	0.074	0.063	3.191	412	0.021	0.017	3wzfA.pdb.gz
18	PDB:7rx3B	0.092	0.061	3.191	591	0.079	0.046	7rx3B.pdb.gz	TMEM16 scramblases thin the membrane to enable lipid scrambling.
19	PDB:4f1iA	0.076	0.079	3.590	328	0.056	0.058	4f1iA.pdb.gz
20	PDB:5adzC	0.083	0.052	3.590	557	0.035	0.022	5adzC.pdb.gz	Discovery of Inhibitors for the Ether Lipid-Generating Enzyme Agps as Anti-Cancer Agents.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q32NN2	0.0	650	341	0.933	0.933	QKIA_XENLA KH domain-containing RNA-binding protein qki.S OS=Xenopus laevis OX=8355 GN=qki.S PE=1 SV=2
2	Q6P0D0	0.0	535	341	0.804	0.804	QKIA_DANRE Protein quaking-A OS=Danio rerio OX=7955 GN=qkia PE=2 SV=2
3	Q6P104	0.0	580	319	0.830	0.887	QKIB_DANRE Protein quaking-B OS=Danio rerio OX=7955 GN=qki2 PE=2 SV=1
4	Q91XU1	0.0	692	341	0.994	0.994	QKI_RAT KH domain-containing RNA-binding protein QKI OS=Rattus norvegicus OX=10116 GN=Qki PE=1 SV=2
5	Q96PU8	0.0	696	341	1.000	1.000	QKI_HUMAN KH domain-containing RNA-binding protein QKI OS=Homo sapiens OX=9606 GN=QKI PE=1 SV=1
6	Q9QYS9	0.0	696	341	1.000	1.000	QKI_MOUSE KH domain-containing RNA-binding protein QKI OS=Mus musculus OX=10090 GN=Qki PE=1 SV=1
7	O01367	2.53e-94	288	405	0.493	0.415	HOW_DROME Protein held out wings OS=Drosophila melanogaster OX=7227 GN=how PE=1 SV=1
8	G5EFF1	7.54e-85	265	445	0.378	0.290	ASD2_CAEEL RNA-binding protein asd-2 OS=Caenorhabditis elegans OX=6239 GN=asd-2 PE=1 SV=1
9	D4YW53	9.32e-85	266	486	0.378	0.265	D4YW53_CAEEL K Homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=asd-2 PE=1 SV=2
10	Q17339	1.88e-76	244	463	0.370	0.272	GLD1_CAEEL Female germline-specific tumor suppressor gld-1 OS=Caenorhabditis elegans OX=6239 GN=gld-1 PE=1 SV=1
11	Q9ZVI3	7.58e-37	135	286	0.191	0.227	QKIL3_ARATH KH domain-containing protein At2g38610 OS=Arabidopsis thaliana OX=3702 GN=At2g38610 PE=1 SV=1
12	Q75GR5	7.44e-36	133	281	0.182	0.221	SPIN1_ORYSJ KH domain-containing protein SPIN1 OS=Oryza sativa subsp. japonica OX=39947 GN=SPIN1 PE=1 SV=1
13	Q9WU01	6.43e-35	132	349	0.229	0.223	KHDR2_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Mus musculus OX=10090 GN=Khdrbs2 PE=1 SV=1
14	Q5VWX1	6.99e-35	132	349	0.229	0.223	KHDR2_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Homo sapiens OX=9606 GN=KHDRBS2 PE=1 SV=1
15	O75525	7.69e-35	132	346	0.273	0.269	KHDR3_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Homo sapiens OX=9606 GN=KHDRBS3 PE=1 SV=1
16	Q920F3	1.14e-34	131	349	0.229	0.223	KHDR2_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Khdrbs2 PE=1 SV=1
17	Q9R226	1.58e-33	128	346	0.258	0.254	KHDR3_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Mus musculus OX=10090 GN=Khdrbs3 PE=1 SV=1
18	Q07666	2.84e-33	129	443	0.246	0.190	KHDR1_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1
19	Q91V33	4.39e-33	129	443	0.246	0.190	KHDR1_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Khdrbs1 PE=1 SV=1
20	Q60749	4.61e-33	129	443	0.246	0.190	KHDR1_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Mus musculus OX=10090 GN=Khdrbs1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00013 KH_1	0.013	26.7	KH domain
2	PF16551 Quaking_NLS	1.9e-17	73.9	Putative nuclear localisation signal of quaking
3	PF16544 STAR_dimer	9e-24	94.1	Homodimerisation region of STAR domain protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000000722

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000004715	0.867	RNA binding protein with multiple splicing
2	9593.ENSGGOP00000011039	0.811	Far upstream element (FUSE) binding protein 3
3	9593.ENSGGOP00000008785	0.807	RNA binding protein with multiple splicing 2
4	9593.ENSGGOP00000015221	0.784	RNA binding protein fox-1 homolog
5	9593.ENSGGOP00000004995	0.777	Polypyrimidine tract binding protein 1
6	9593.ENSGGOP00000026066	0.756	DEAD (Asp-Glu-Ala-Asp) box helicase 6
7	9593.ENSGGOP00000003452	0.749	Eukaryotic translation initiation factor 4E nuclear import factor 1
8	9593.ENSGGOP00000015125	0.727	Heterogeneous nuclear ribonucleoprotein K
9	9593.ENSGGOP00000018236	0.714	ATP-binding cassette, sub-family A (ABC1), member 3
10	9593.ENSGGOP00000011327	0.701	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
11	9593.ENSGGOP00000008752	0.696	Mitogen-activated protein kinase 3
12	9593.ENSGGOP00000007401	0.695	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
13	9593.ENSGGOP00000020350	0.688	Integrator complex subunit 1
14	9593.ENSGGOP00000000648	0.686	Polypyrimidine tract binding protein 2
15	9593.ENSGGOP00000016464	0.685	RNA binding protein fox-1 homolog
16	9593.ENSGGOP00000003837	0.682	ADP-dependent glucokinase
17	9593.ENSGGOP00000012869	0.681	ALMS1, centrosome and basal body associated protein
18	9593.ENSGGOP00000000581	0.680	Leucine zipper, putative tumor suppressor 1
19	9593.ENSGGOP00000025548	0.676	Zinc finger protein 384
20	9593.ENSGGOP00000027001	0.656	Heterogeneous nuclear ribonucleoprotein K

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003727	0.844	single-stranded RNA binding
GO:0042802	0.573	identical protein binding
GO:0008266	0.392	poly(U) RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0048856	0.954	anatomical structure development
GO:0050794	0.922	regulation of cellular process
GO:0010468	0.868	regulation of gene expression
GO:0008152	0.830	metabolic process
GO:0048518	0.820	positive regulation of biological process
GO:0071704	0.806	organic substance metabolic process
GO:0080090	0.774	regulation of primary metabolic process
GO:0051171	0.773	regulation of nitrogen compound metabolic process
GO:0044238	0.760	primary metabolic process
GO:0032501	0.742	multicellular organismal process
GO:0044237	0.742	cellular metabolic process
GO:0031323	0.742	regulation of cellular metabolic process
GO:0006807	0.636	nitrogen compound metabolic process
GO:0010604	0.620	positive regulation of macromolecule metabolic process
GO:0043170	0.581	macromolecule metabolic process
GO:0007275	0.546	multicellular organism development
GO:0019219	0.520	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.501	regulation of RNA metabolic process
GO:0048522	0.458	positive regulation of cellular process
GO:0048519	0.446	negative regulation of biological process
GO:0048523	0.436	negative regulation of cellular process
GO:0048869	0.433	cellular developmental process
GO:1903311	0.409	regulation of mRNA metabolic process
GO:0034641	0.391	cellular nitrogen compound metabolic process
GO:0046483	0.383	heterocycle metabolic process
GO:0010628	0.360	positive regulation of gene expression
GO:0071840	0.341	cellular component organization or biogenesis
GO:1901360	0.335	organic cyclic compound metabolic process
GO:0048731	0.322	system development
GO:0006139	0.319	nucleobase-containing compound metabolic process
GO:0010605	0.305	negative regulation of macromolecule metabolic process
GO:0016043	0.302	cellular component organization
GO:0030154	0.300	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.954	cytoplasm
GO:0005829	0.420	cytosol
GO:0070013	0.367	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]