StarFunc result for job id Q96PU9

User Input

>input (254 residues)
MTEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLL
AENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQTKTMLTPGPGDYFPEKSTKYVFDSAP
SHSISARTKAFRVDSTPGPAAYMLPMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTP
GPAAYRQTDVRVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLTKPCAPVVTFGI
KHSDYMTPLLVDVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
	1	AFDB:Q920N1	0.231	0.231	1.888E-34	254	0.937	0.937	Q920N1.pdb.gz	CMA1A_MOUSE Ciliary microtubule associated protein 1A OS=Mus musculus OX=10090 GN=Cimap1a PE=1 SV=2
	2	AFDB:A8MYP8	0.169	0.169	3.905E-18	253	0.457	0.458	A8MYP8.pdb.gz	CMA1B_HUMAN Ciliary microtubule associated protein 1B OS=Homo sapiens OX=9606 GN=CIMAP1B PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96PU9	0.0	516	254	1.000	1.000	CMA1A_HUMAN Ciliary microtubule associated protein 1A OS=Homo sapiens OX=9606 GN=CIMAP1A PE=1 SV=1
2	Q920N1	1.24e-177	490	254	0.937	0.937	CMA1A_MOUSE Ciliary microtubule associated protein 1A OS=Mus musculus OX=10090 GN=Cimap1a PE=1 SV=2
3	A8MYP8	4.68e-70	217	253	0.461	0.462	CMA1B_HUMAN Ciliary microtubule associated protein 1B OS=Homo sapiens OX=9606 GN=CIMAP1B PE=1 SV=1
4	B3DI43	2.15e-54	177	252	0.382	0.385	B3DI43_DANRE Outer dense fiber of sperm tails 3-like 2b OS=Danio rerio OX=7955 GN=cimap1d PE=2 SV=1
5	Q8IXM7	2.00e-36	132	274	0.323	0.299	CMA1C_HUMAN Protein CIMAP1C OS=Homo sapiens OX=9606 GN=CIMAP1C PE=1 SV=1
6	Q3SX64	2.11e-35	129	289	0.315	0.277	CMA1D_HUMAN Protein CIMAP1D OS=Homo sapiens OX=9606 GN=CIMAP1D PE=1 SV=2
7	M9PCD3	2.01e-22	94.7	261	0.339	0.330	M9PCD3_DROME Uncharacterized protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
8	Q9VLQ4	1.25e-20	90.1	272	0.343	0.320	Q9VLQ4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=2
9	Q8IPG0	2.81e-20	89.7	298	0.343	0.292	Q8IPG0_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=CG8113 PE=4 SV=1
10	M9PB71	1.21e-14	75.5	1603	0.315	0.050	M9PB71_DROME Uncharacterized protein, isoform I OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
11	M9NCS7	1.72e-14	75.1	1569	0.276	0.045	M9NCS7_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
12	M9PF71	1.75e-14	75.1	1516	0.276	0.046	M9PF71_DROME Uncharacterized protein, isoform O OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
13	Q7KTI6	1.80e-14	75.1	1453	0.276	0.048	Q7KTI6_DROME Uncharacterized protein, isoform J OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=3
14	M9PCX6	1.84e-14	75.1	1448	0.276	0.048	M9PCX6_DROME Uncharacterized protein, isoform N OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
15	M9PCJ4	1.86e-14	75.1	1512	0.276	0.046	M9PCJ4_DROME Uncharacterized protein, isoform M OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
16	M9PB72	1.93e-14	75.1	1501	0.276	0.047	M9PB72_DROME Uncharacterized protein, isoform P OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
17	Q7KTI5	1.98e-14	75.1	1534	0.276	0.046	Q7KTI5_DROME Uncharacterized protein, isoform L OS=Drosophila melanogaster OX=7227 GN=CG8113 PE=4 SV=3
18	M9NEC3	2.04e-14	74.7	1568	0.276	0.045	M9NEC3_DROME Uncharacterized protein, isoform H OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
19	Q961P7	9.44e-07	51.6	426	0.201	0.120	Q961P7_DROME GH11964p OS=Drosophila melanogaster OX=7227 GN=CG8113 PE=2 SV=1
20	Q57XU0	1.24e-04	45.4	2395	0.217	0.023	Q57XU0_TRYB2 Sperm-tail PG-rich repeat OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.130 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07004 SHIPPO-rpt	1.8e-10	52.4	Sperm-tail PG-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012806

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000007705	0.689	Outer dense fiber of sperm tails 4
2	9593.ENSGGOP00000027762	0.688	Ecotropic viral integration site 5
3	9593.ENSGGOP00000005601	0.667	Rhophilin, Rho GTPase binding protein 1
4	9593.ENSGGOP00000022250	0.648	RNA polymerase II associated protein 3
5	9593.ENSGGOP00000026819	0.648	Dynein, axonemal, heavy chain 2
6	9593.ENSGGOP00000016372	0.646	Zona pellucida binding protein
7	9593.ENSGGOP00000000694	0.614	Cytochrome b reductase 1
8	9593.ENSGGOP00000020283	0.604	Solute carrier family 12 (sodium/chloride transporter), member 3
9	9593.ENSGGOP00000023132	0.595	Regulator of G-protein signaling 3
10	9593.ENSGGOP00000001939	0.592	Ecotropic viral integration site 5-like
11	9593.ENSGGOP00000002579	0.586	Sperm associated antigen 6
12	9593.ENSGGOP00000016174	0.570	Clusterin associated protein 1
13	9593.ENSGGOP00000016787	0.570	SAS-6 centriolar assembly protein
14	9593.ENSGGOP00000016728	0.565	Testis, prostate and placenta expressed
15	9593.ENSGGOP00000016253	0.562	Thyrotropin-releasing hormone receptor
16	9593.ENSGGOP00000012004	0.536	G protein-coupled receptor 151
17	9593.ENSGGOP00000006072	0.534	HESX homeobox 1
18	9593.ENSGGOP00000021039	0.525	Napsin A aspartic peptidase
19	9593.ENSGGOP00000024334	0.523	Outer dense fiber of sperm tails 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.994	multicellular organismal process
GO:0007605	0.956	sensory perception of sound
GO:0009987	0.592	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	0.998	cilium
GO:0099513	0.998	polymeric cytoskeletal fiber
GO:0036126	0.992	sperm flagellum
GO:0043231	0.823	intracellular membrane-bounded organelle
GO:0005737	0.742	cytoplasm
GO:0005634	0.736	nucleus
GO:0001520	0.725	outer dense fiber
GO:0005829	0.361	cytosol
GO:0032991	0.342	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]