StarFunc result for job id Q96PX9

User Input

>input (1271 residues)
MEALRNPMPLGSSEEALGDLACSSLTGASRDLGTGAVASGTQEETSGPRGDPQQTPSLEK
ERHTPSRTGPGAAGRTLPRRSRSWERAPRSSRGAQAAACHTSHHSAGSRPGGHLGGQAVG
TPNCVPVEGPGCTKEEDVLASSACVSTDGGSLHCHNPSGPSDVPARQPHPEQEGWPPGTG
DFPSQVPKQVLDVSQELLQSGVVTLPGTRDRHGRAVVQVRTRSLLWTREHSSCAELTRLL
LYFHSIPRKEVRDLGLVVLVDARRSPAAPAVSQALSGLQNNTSPIIHSILLLVDKESAFR
PDKDAIIQCEVVSSLKAVHKFVDSCQLTADLDGSFPYSHGDWICFRQRLEHFAANCEEAI
IFLQNSFCSLNTHRTPRTAQEVAELIDQHETMMKLVLEDPLLVSLRLEGGTVLARLRREE
LGTEDSRDTLEAATSLYDRVDEEVHRLVLTSNNRLQQLEHLRELASLLEGNDQQSCQKGL
QLAKENPQRTEEMVQDFRRGLSAVVSQAECREGELARWTRSSELCETVSSWMGPLDPEAC
PSSPVAECLRSCHQEATSVAAEAFPGAGVAVLKPHALGKPWASQQDLWLQYPQTRLRLEE
ALSEAAPDPSLPPLAQSPPKHERAQEAMRRHQKPPSFPSTDSGGGAWEPAQPLSGLPGRA
LLCGQDGETLRPGLCALWDPLSLLRGLPGAGATTAHLEDSSACSSEPTQTLASRPRKHPQ
KKMIKKTQSFEIPQPDSGPRDSCQPDHTSVFSKGLEVTSTVATEKKLPLWQHARSPPVTQ
SRSLSSPSGLHPAEEDGRQQVGSSRLRHIMAEMIATEREYIRCLGYVIDNYFPEMERMDL
PQGLRGKHHVIFGNLEKLHDFHQQHFLRELERCQHCPLAVGRSFLRHEEQFGMYVIYSKN
KPQSDALLSSHGNAFFKDKQRELGDKMDLASYLLRPVQRVAKYALLLQDLLKEASCGLAQ
GQELGELRAAEVVVCFQLRHGNDLLAMDAIRGCDVNLKEQGQLRCRDEFIVCCGRKKYLR
HVFLFEDLILFSKTQKVEGSHDVYLYKQSFKTAEIGMTENVGDSGLRFEIWFRRRRKSQD
TYILQASSAEVKSAWTDVIGRILWRQALKSRELRIQEMASMGIGNQPFMDVKPRDRTPDC
AVISDRAPKCAVMSDRVPDSIVKGTESQMRGSTAVSSSDHAAPFKRPHSTISDSSTSSSS
SQSSSILGSLGLLVSSSPAHPGLWSPAHSPWSSDIRACVEEDEPEPELETGTQAAVCEGA
PAVLLSRTRQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96PX9	1.000	1.000	0.000	1271	1.000	1.000	Q96PX9.pdb.gz	PKH4B_HUMAN Pleckstrin homology domain-containing family G member 4B OS=Homo sapiens OX=9606 GN=PLEKHG4B PE=1 SV=4
2	AFDB:A0A2R8QD21	0.307	0.219	8.814E-67	1989	0.360	0.230	A0A2R8QD21.pdb.gz
3	AFDB:Q58EX7	0.403	0.427	4.295E-63	1191	0.327	0.348	Q58EX7.pdb.gz	PKHG4_HUMAN Puratrophin-1 OS=Homo sapiens OX=9606 GN=PLEKHG4 PE=1 SV=1
4	AFDB:Q86VW2	0.218	0.424	2.473E-26	580	0.115	0.252	Q86VW2.pdb.gz	ARHGP_HUMAN Rho guanine nucleotide exchange factor 25 OS=Homo sapiens OX=9606 GN=ARHGEF25 PE=1 SV=2
5	PDB:4mt6A	0.172	0.430	2.390E-14	389	0.061	0.198	4mt6A.pdb.gz
6	AFDB:Q6ZNL6	0.127	0.111	4.499E-14	1462	0.144	0.125	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
7	PDB:7rx9A	0.126	0.351	4.706E-14	432	0.063	0.185	7rx9A.pdb.gz
8	AFDB:D1MYR8	0.188	0.230	2.740E-13	1007	0.087	0.109	D1MYR8.pdb.gz	D1MYR8_9HYPO Guanine-nucleotide exchange factor Cdc24 OS=Epichloe festucae OX=35717 GN=Cdc24 PE=1 SV=1
9	AFDB:Q12774	0.156	0.130	2.397E-11	1597	0.125	0.100	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
10	AFDB:E9Q7D5	0.154	0.129	1.528E-10	1581	0.131	0.105	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
11	AFDB:Q5JU85	0.110	0.095	3.147E-10	1488	0.147	0.126	Q5JU85.pdb.gz	IQEC2_HUMAN IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=IQSEC2 PE=1 SV=2
12	AFDB:Q9UTR5	0.169	0.183	1.115E-9	1158	0.076	0.083	Q9UTR5.pdb.gz	RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf2 PE=1 SV=1
13	PDB:4gouA	0.127	0.305	2.519E-6	507	0.039	0.099	4gouA.pdb.gz
14	PDB:6u3eA	0.068	0.196	1.283E-3	397	0.040	0.128	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:7wvtA	0.106	0.299	1.537E-3	364	0.028	0.096	7wvtA.pdb.gz	Structural basis of ligand recognition and transport by Sfh2, a yeast phosphatidylinositol transfer protein of the Sec14 superfamily.
16	PDB:4mk0A	0.075	0.140	1.927E-3	631	0.024	0.048	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	PDB:6bbpA	0.078	0.160	2.766E-3	520	0.031	0.077	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
18	PDB:4tlgA	0.096	0.275	4.153E-3	396	0.020	0.063	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
19	PDB:5yqrA	0.070	0.287	9.363E-3	268	0.022	0.104	5yqrA.pdb.gz
20	PDB:4cizA	0.105	0.411	9.795E-3	284	0.020	0.088	4cizA.pdb.gz	Human Cellular Retinaldehyde-Binding Protein Has Secondary Thermal 9-Cis-Retinal Isomerase Activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96PX9	0.0	2601	1271	1.000	1.000	PKH4B_HUMAN Pleckstrin homology domain-containing family G member 4B OS=Homo sapiens OX=9606 GN=PLEKHG4B PE=1 SV=4
2	Q58EX7	5.06e-133	439	1191	0.179	0.191	PKHG4_HUMAN Puratrophin-1 OS=Homo sapiens OX=9606 GN=PLEKHG4 PE=1 SV=1
3	Q6DN89	6.35e-131	446	1989	0.162	0.104	Q6DN89_DANRE Quattro OS=Danio rerio OX=7955 GN=sb:cb9 PE=2 SV=1
4	F8VPS6	3.38e-129	429	1181	0.174	0.187	F8VPS6_MOUSE Pleckstrin homology domain containing, family G (with RhoGef domain) member 4 OS=Mus musculus OX=10090 GN=Plekhg4 PE=1 SV=1
5	Q7KU87	5.66e-117	388	872	0.150	0.219	Q7KU87_DROME FI18828p1 OS=Drosophila melanogaster OX=7227 GN=Pura PE=2 SV=1
6	Q86NW6	3.63e-114	388	1191	0.150	0.160	Q86NW6_DROME GM01778p OS=Drosophila melanogaster OX=7227 GN=Pura PE=2 SV=1
7	Q7KU88	2.67e-113	389	1428	0.150	0.134	Q7KU88_DROME Puratrophin-1-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Pura PE=4 SV=2
8	M9PEF7	4.53e-112	390	1898	0.150	0.101	M9PEF7_DROME Puratrophin-1-like, isoform D OS=Drosophila melanogaster OX=7227 GN=Pura PE=4 SV=1
9	Q7KU89	6.98e-112	390	1904	0.150	0.100	Q7KU89_DROME Puratrophin-1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Pura PE=4 SV=2
10	Q8TER5	4.79e-83	301	1519	0.138	0.116	ARH40_HUMAN Rho guanine nucleotide exchange factor 40 OS=Homo sapiens OX=9606 GN=ARHGEF40 PE=1 SV=3
11	Q9CWR0	5.85e-56	208	618	0.094	0.193	ARHGP_MOUSE Rho guanine nucleotide exchange factor 25 OS=Mus musculus OX=10090 GN=Arhgef25 PE=1 SV=1
12	Q86VW2	1.33e-53	200	580	0.080	0.176	ARHGP_HUMAN Rho guanine nucleotide exchange factor 25 OS=Homo sapiens OX=9606 GN=ARHGEF25 PE=1 SV=2
13	A0A2R8RHL8	1.30e-52	206	2306	0.093	0.051	A0A2R8RHL8_DANRE Kalirin RhoGEF kinase b OS=Danio rerio OX=7955 GN=wu:fc60a10 PE=4 SV=1
14	Q63406	1.56e-52	204	1149	0.096	0.106	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3
15	Q6PDM6	1.59e-52	204	1166	0.096	0.105	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
16	P97924	1.71e-52	206	2959	0.094	0.040	KALRN_RAT Kalirin OS=Rattus norvegicus OX=10116 GN=Kalrn PE=1 SV=3
17	O60229	2.50e-52	205	2986	0.093	0.040	KALRN_HUMAN Kalirin OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=3
18	H7BXZ5	2.51e-52	205	2955	0.093	0.040	H7BXZ5_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=1
19	A2CG49	3.11e-52	204	2964	0.094	0.040	KALRN_MOUSE Kalirin OS=Mus musculus OX=10090 GN=Kalrn PE=1 SV=1
20	O15068	3.29e-52	203	1137	0.098	0.110	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16453 IQ_SEC7_PH	4.3	18.7	PH domain
2	PF00169 PH	1	21.3	PH domain
3	PF15411 PH_10	1.3e+02	14.3	Pleckstrin homology domain
4	PF00621 RhoGEF	3e-25	101.0	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283426

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344961	0.820	Pleckstrin homology and RhoGEF domain containing G7
2	9606.ENSP00000313670	0.651	ALS2 C-terminal-like protein
3	9606.ENSP00000371253	0.636	Trifunctional purine biosynthetic protein adenosine-3
4	9606.ENSP00000332773	0.631	Immunoglobulin superfamily DCC subclass member 3
5	9606.ENSP00000442307	0.560	Epithelial cell-transforming sequence 2 oncogene-like
6	9606.ENSP00000325076	0.517	Olfactory receptor 10G4
7	9606.ENSP00000361423	0.517	Tyrosine-protein kinase ABL1
8	9606.ENSP00000416125	0.516	Rho guanine nucleotide exchange factor 38
9	9606.ENSP00000334452	0.506	Olfactory receptor 13F1
10	9606.ENSP00000427562	0.505	Abelson tyrosine-protein kinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0051056	0.936	regulation of small GTPase mediated signal transduction
GO:0009987	0.372	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]