StarFunc result for job id Q96PY5

User Input

>input (1086 residues)
MGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLNAMNLPPDKARLLRQYDNEKK
WELICDQERFQVKNPPHTYIQKLKGYLDPAVTRKKFRRRVQESTQVLRELEISLRTNHIG
WVREFLNEENKGLDVLVEYLSFAQYAVTFDFESVESTVESSVDKSKPWSRSIEDLHRGSN
LPSPVGNSVSRSGRHSALRYNTLPSRRTLKNSRLVSKKDDVHVCIMCLRAIMNYQYGFNM
VMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCGEKQRF
EKLMEHFRNEDNNIDFMVASMQFINIVVHSVEDMNFRVHLQYEFTKLGLDEYLDKLKHTE
SDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENISHLSEKLQDTENEAMSKI
VELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGT
IKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGPTMGAASSGPLPPPPPPLPPSSDTP
ETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLPGT
SSPTVVFNSGLAAVKIKKPIKTKFRMPVFNWVALKPNQINGTVFNEIDDERILEDLNVDE
FEEIFKTKAQGPAIDLSSSKQKIPQKGSNKVTLLEANRAKNLAITLRKAGKTADEICKAI
HVFDLKTLPVDFVECLMRFLPTENEVKVLRLYERERKPLENLSDEDRFMMQFSKIERLMQ
KMTIMAFIGNFAESIQMLTPQLHAIIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAV
YGFKLQSLDLLLDTKSTDRKQTLLHYISNVVKEKYHQVSLFYNELHYVEKAAAVSLENVL
LDVKELQRGMDLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGE
NPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHK
SKRQQQELIAELRRRQVKDNRHVYEGKDGAIEDIITVLKTVPFTARTAKRGSRFFCEPVL
TEEYHY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96PY5	1.000	1.000	0.000	1086	1.000	1.000	Q96PY5.pdb.gz	FMNL2_HUMAN Formin-like protein 2 OS=Homo sapiens OX=9606 GN=FMNL2 PE=1 SV=3
2	AFDB:Q6NXC0	0.580	0.598	2.228E-95	1047	0.703	0.729	Q6NXC0.pdb.gz	FMNL3_DANRE Formin-like protein 3 OS=Danio rerio OX=7955 GN=fmnl3 PE=2 SV=2
3	AFDB:Q6ZPF4	0.647	0.679	5.080E-92	1028	0.689	0.728	Q6ZPF4.pdb.gz	FMNL3_MOUSE Formin-like protein 3 OS=Mus musculus OX=10090 GN=Fmnl3 PE=1 SV=2
4	AFDB:O95466	0.369	0.364	2.645E-80	1100	0.598	0.590	O95466.pdb.gz	FMNL1_HUMAN Formin-like protein 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=3
5	AFDB:Q9JL26	0.609	0.605	1.647E-79	1094	0.568	0.564	Q9JL26.pdb.gz	FMNL1_MOUSE Formin-like protein 1 OS=Mus musculus OX=10090 GN=Fmnl1 PE=1 SV=1
6	AFDB:Q54N00	0.303	0.303	1.408E-31	1087	0.201	0.201	Q54N00.pdb.gz	FORH_DICDI Formin-H OS=Dictyostelium discoideum OX=44689 GN=forH PE=1 SV=1
7	AFDB:K7EJE6	0.289	0.632	1.749E-29	488	0.208	0.463	K7EJE6.pdb.gz	K7EJE6_HUMAN Formin like 1 (Fragment) OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=1
8	AFDB:Q54SP2	0.278	0.269	1.135E-28	1126	0.226	0.218	Q54SP2.pdb.gz	FORB_DICDI Formin-B OS=Dictyostelium discoideum OX=44689 GN=forB PE=1 SV=1
9	AFDB:Q5TJ56	0.267	0.239	4.156E-26	1220	0.213	0.189	Q5TJ56.pdb.gz	FORF_DICDI Formin-F OS=Dictyostelium discoideum OX=44689 GN=forF PE=1 SV=1
10	AFDB:Q5AAF4	0.269	0.202	2.911E-22	1485	0.225	0.164	Q5AAF4.pdb.gz	BNR1_CANAL Formin BNR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BNR1 PE=1 SV=1
11	PDB:6ahd1	0.121	0.124	2.885E-2	1048	0.048	0.050	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
12	PDB:2z6gA	0.166	0.311	9.631E-2	550	0.034	0.067	2z6gA.pdb.gz
13	PDB:3zhpA	0.124	0.317	2.838E-1	315	0.037	0.127	3zhpA.pdb.gz
14	PDB:3tpoA	0.141	0.294	3.352E-1	438	0.022	0.055	3tpoA.pdb.gz
15	PDB:4ct7B	0.164	0.533	3.494E-1	269	0.029	0.119	4ct7B.pdb.gz	Structural and Biochemical Insights to the Role of the Ccr4-not Complex and Ddx6 ATPase in Microrna Repression.
16	PDB:5wbjA	0.132	0.135	3.494E-1	1058	0.051	0.052	5wbjA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
17	PDB:7wttK	0.117	0.123	3.642E-1	1022	0.039	0.041	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
18	PDB:4r0zA	0.160	0.291	4.484E-1	557	0.038	0.074	4r0zA.pdb.gz
19	PDB:1b3uA	0.096	0.151	4.674E-1	588	0.036	0.066	1b3uA.pdb.gz
20	PDB:7dvqK	0.121	0.607	4.674E-1	188	0.024	0.138	7dvqK.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8W1F5	0.0	763	1027	0.331	0.351	F8W1F5_HUMAN Formin like 3 OS=Homo sapiens OX=9606 GN=FMNL3 PE=1 SV=1
2	Q6NXC0	0.0	1487	1047	0.692	0.718	FMNL3_DANRE Formin-like protein 3 OS=Danio rerio OX=7955 GN=fmnl3 PE=2 SV=2
3	Q6ZN96	0.0	1090	568	0.496	0.949	Q6ZN96_HUMAN cDNA FLJ16308 fis, clone PUAEN2006335 OS=Homo sapiens OX=9606 PE=1 SV=1
4	Q6ZPF4	0.0	759	1028	0.331	0.350	FMNL3_MOUSE Formin-like protein 3 OS=Mus musculus OX=10090 GN=Fmnl3 PE=1 SV=2
5	Q8IVF7	0.0	763	1028	0.331	0.350	FMNL3_HUMAN Formin-like protein 3 OS=Homo sapiens OX=9606 GN=FMNL3 PE=1 SV=3
6	Q96PY5	0.0	2236	1086	1.000	1.000	FMNL2_HUMAN Formin-like protein 2 OS=Homo sapiens OX=9606 GN=FMNL2 PE=1 SV=3
7	Q9VUC6	0.0	664	1183	0.360	0.331	FRL_DROME Formin-like protein OS=Drosophila melanogaster OX=7227 GN=Frl PE=1 SV=3
8	O95466	3.56e-177	550	1100	0.251	0.248	FMNL1_HUMAN Formin-like protein 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=3
9	K7EK60	1.04e-171	522	682	0.239	0.381	K7EK60_HUMAN Formin like 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=1
10	Q9JL26	1.59e-165	519	1094	0.234	0.232	FMNL1_MOUSE Formin-like protein 1 OS=Mus musculus OX=10090 GN=Fmnl1 PE=1 SV=1
11	K7EJE6	1.11e-144	444	488	0.207	0.461	K7EJE6_HUMAN Formin like 1 (Fragment) OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=1
12	A0A0R4IER9	5.41e-54	207	1060	0.122	0.125	A0A0R4IER9_DANRE Disheveled-associated activator of morphogenesis 1 isoform X2 OS=Danio rerio OX=7955 GN=daam1a PE=4 SV=1
13	Q5RHJ3	2.33e-51	199	1079	0.116	0.117	Q5RHJ3_DANRE Disheveled-associated activator of morphogenesis 1 OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
14	B3DJI0	2.67e-51	199	1069	0.115	0.117	B3DJI0_DANRE Daam1l protein OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
15	Q9Y4D1	1.09e-49	194	1078	0.129	0.130	DAAM1_HUMAN Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=2
16	Q86T65	1.81e-47	187	1068	0.102	0.104	DAAM2_HUMAN Disheveled-associated activator of morphogenesis 2 OS=Homo sapiens OX=9606 GN=DAAM2 PE=1 SV=3
17	Q8IRY0	7.17e-46	182	1153	0.163	0.154	Q8IRY0_DROME Dishevelled associated activator of morphogenesis, isoform B OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
18	Q7YZA4	7.99e-46	182	1114	0.163	0.159	Q7YZA4_DROME Dishevelled associated activator of morphogenesis, isoform A OS=Drosophila melanogaster OX=7227 GN=DAAM PE=1 SV=1
19	M9MSM5	1.65e-45	181	1463	0.180	0.133	M9MSM5_DROME Dishevelled associated activator of morphogenesis, isoform D OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
20	Q8MT16	2.54e-45	180	1114	0.162	0.158	Q8MT16_DROME RH61354p OS=Drosophila melanogaster OX=7227 GN=DAAM PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06367 Drf_FH3	4.5e-46	168.5	Diaphanous FH3 Domain
2	PF06371 Drf_GBD	4.4e-22	90.1	Diaphanous GTPase-binding Domain
3	PF02181 FH2	9.5e-100	345.9	Formin Homology 2 Domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9668.ENSMPUP00000000406

Rank	PPI partner	STRING score	Description
1	9668.ENSMPUP00000004181	0.949	Cell division cycle 42
2	9668.ENSMPUP00000015893	0.949	Uncharacterized protein
3	9668.ENSMPUP00000005105	0.859	Ras homolog family member C
4	9668.ENSMPUP00000013737	0.763	Ras homolog family member A
5	9668.ENSMPUP00000002541	0.689	Profilin 2
6	9668.ENSMPUP00000006151	0.661	Dishevelled associated activator of morphogenesis 1
7	9668.ENSMPUP00000013706	0.646	Nicolin 1
8	9668.ENSMPUP00000019359	0.638	Ras homolog family member B
9	9668.ENSMPUP00000019002	0.636	Profilin
10	9668.ENSMPUP00000000536	0.630	annotation not available
11	9668.ENSMPUP00000001507	0.630	Uncharacterized protein
12	9668.ENSMPUP00000002340	0.630	Uncharacterized protein
13	9668.ENSMPUP00000011518	0.630	Uncharacterized protein
14	9668.ENSMPUP00000015764	0.630	Uncharacterized protein
15	9668.ENSMPUP00000009783	0.621	BCL2-associated athanogene 4
16	9668.ENSMPUP00000001693	0.599	Uncharacterized protein
17	9668.ENSMPUP00000012588	0.599	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
18	9668.ENSMPUP00000016476	0.599	annotation not available
19	9668.ENSMPUP00000016509	0.594	Actin, beta
20	9668.ENSMPUP00000008555	0.587	Formin-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	1.000	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.987	regulation of biological process
GO:0016043	0.980	cellular component organization
GO:0030036	0.959	actin cytoskeleton organization
GO:0050794	0.808	regulation of cellular process
GO:0022604	0.617	regulation of cell morphogenesis
GO:0048518	0.399	positive regulation of biological process
GO:0048522	0.380	positive regulation of cellular process
GO:0032501	0.353	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.975	intracellular membrane-bounded organelle
GO:0016020	0.948	membrane
GO:0071944	0.889	cell periphery
GO:0005886	0.851	plasma membrane
GO:0005634	0.733	nucleus
GO:0012505	0.708	endomembrane system
GO:0070013	0.357	intracellular organelle lumen
GO:0005654	0.310	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]