StarFunc result for job id Q96PY6

User Input

>input (1258 residues)
MEKYVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKH
PNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVH
DRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPY
NNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFK
RNPRDRPSVNSILEKGFIAKRIEKFLSPQLIAEEFCLKTFSKFGSQPIPAKRPASGQNSI
SVMPAQKITKPAAKYGIPLAYKKYGDKKLHEKKPLQKHKQAHQTPEKRVNTGEERRKISE
EAARKRRLEFIEKEKKQKDQIISLMKAEQMKRQEKERLERINRAREQGWRNVLSAGGSGE
VKAPFLGSGGTIAPSSFSSRGQYEHYHAIFDQMQQQRAEDNEAKWKREIYGRGLPERGIL
PGVRPGFPYGAAGHHHFPDADDIRKTLKRLKAVSKQANANRQKGQLAVERAKQVEEFLQR
KREAMQNKARAEGHMVYLARLRQIRLQNFNERQQIKAKLRGEKKEANHSEGQEGSEEADM
RRKKIESLKAHANARAAVLKEQLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHE
TGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENL
KAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFS
TTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEG
EKYKPLITGEKKVQCISHEINPSAIVDSPVETKSPEFSEASPQMSLKLEGNLEEPDDLET
EILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRITIQENEVSEDGVSSTVDQLSD
IHIEPGTNDSQHSKCDVDKSVQPEPFFHKVVHSEHLNLVPQVQSVQCSPEESFAFRSHSH
LPPKNKNKNSLLIGLSTGLFDANNPKMLRTCSLPDLSKLFRTLMDVPTVGDVRQDNLEID
EIEDENIKEGPSDSEDIVFEETDTDLQELQASMEQLLREQPGEEYSEEEESVLKNSDVEP
TANGTDVADEDDNPSSESALNEEWHSDNSDGEIASECECDSVFNHLEELRLHLEQEMGFE
KFFEVYEKIKAIHEDEDENIEICSKIVQNILGNEHQHLYAKILHLVMADGAYQEDNDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51954	0.447	0.465	0.000	1203	0.792	0.828	P51954.pdb.gz	NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus OX=10090 GN=Nek1 PE=1 SV=2
2	AFDB:Q96PY6	1.000	1.000	0.000	1258	1.000	1.000	Q96PY6.pdb.gz	NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens OX=9606 GN=NEK1 PE=1 SV=2
3	AFDB:X1WHD3	0.216	0.958	2.488E-46	281	0.186	0.833	X1WHD3.pdb.gz
4	AFDB:Q388G0	0.208	0.174	5.213E-34	1506	0.188	0.157	Q388G0.pdb.gz	Q388G0_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2330 PE=4 SV=1
5	AFDB:Q9R0A5	0.203	0.487	5.691E-31	511	0.135	0.333	Q9R0A5.pdb.gz	NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus OX=10090 GN=Nek3 PE=1 SV=2
6	AFDB:Q91ZR4	0.206	0.367	9.915E-31	698	0.103	0.185	Q91ZR4.pdb.gz	NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus OX=10090 GN=Nek8 PE=1 SV=1
7	AFDB:Q38CJ2	0.215	0.349	1.108E-30	764	0.157	0.259	Q38CJ2.pdb.gz	Q38CJ2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7860 PE=4 SV=1
8	AFDB:Q90XC2	0.206	0.369	1.309E-30	697	0.105	0.189	Q90XC2.pdb.gz	NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio OX=7955 GN=nek8 PE=2 SV=1
9	AFDB:Q0WPH8	0.203	0.264	1.886E-27	956	0.172	0.227	Q0WPH8.pdb.gz	NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana OX=3702 GN=NEK5 PE=1 SV=1
10	PDB:6s73A	0.191	0.847	8.027E-23	269	0.076	0.357	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
11	AFDB:Q12263	0.191	0.210	4.021E-22	1142	0.147	0.162	Q12263.pdb.gz	GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIN4 PE=1 SV=1
12	PDB:5u6yA	0.188	0.493	3.410E-20	459	0.068	0.185	5u6yA.pdb.gz
13	PDB:3uc3A	0.182	0.776	1.527E-19	272	0.055	0.254	3uc3A.pdb.gz	Structural basis for basal activity and autoactivation of abscisic acid (ABA) signaling SnRK2 kinases.
14	PDB:7myjC	0.197	0.516	2.252E-19	465	0.064	0.172	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
15	PDB:4c0tA	0.196	0.783	2.516E-19	291	0.056	0.244	4c0tA.pdb.gz
16	PDB:4eomC	0.188	0.807	3.511E-19	276	0.061	0.279	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
17	PDB:4rerA	0.198	0.522	3.511E-19	459	0.058	0.159	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:6b1uA	0.197	0.543	3.924E-19	442	0.056	0.158	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
19	PDB:4d28C	0.188	0.804	4.148E-19	279	0.059	0.265	4d28C.pdb.gz
20	PDB:4zhxA	0.201	0.593	4.384E-19	409	0.055	0.169	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51954	0.0	1998	1203	0.793	0.829	NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus OX=10090 GN=Nek1 PE=1 SV=2
2	Q96PY6	0.0	2597	1258	1.000	1.000	NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens OX=9606 GN=NEK1 PE=1 SV=2
3	Q7TSC3	2.28e-108	357	627	0.129	0.258	NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus OX=10090 GN=Nek5 PE=2 SV=1
4	P51956	5.13e-106	346	506	0.120	0.298	NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens OX=9606 GN=NEK3 PE=1 SV=2
5	Q9R0A5	1.95e-101	334	511	0.120	0.295	NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus OX=10090 GN=Nek3 PE=1 SV=2
6	Q5M813	6.23e-94	306	309	0.108	0.440	Q5M813_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=2 SV=1
7	Q38CJ2	2.69e-90	311	764	0.106	0.174	Q38CJ2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7860 PE=4 SV=1
8	A0A8I5ZKL8	3.84e-90	310	743	0.108	0.183	A0A8I5ZKL8_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
9	A0A8I5ZLB3	5.66e-90	310	756	0.108	0.180	A0A8I5ZLB3_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
10	D3ZDV9	7.83e-90	310	793	0.108	0.172	D3ZDV9_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=4 SV=2
11	P51957	8.73e-90	311	841	0.107	0.161	NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens OX=9606 GN=NEK4 PE=1 SV=2
12	A0A8I6A574	1.92e-89	310	829	0.108	0.164	A0A8I6A574_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
13	Q9Z1J2	2.55e-89	309	792	0.107	0.170	NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus OX=10090 GN=Nek4 PE=1 SV=1
14	Q57V67	7.34e-84	285	503	0.104	0.260	Q57V67_TRYB2 Serine/threonine-protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.210 PE=4 SV=1
15	Q388G0	1.85e-79	290	1506	0.100	0.084	Q388G0_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2330 PE=4 SV=1
16	Q86SG6	3.01e-70	252	692	0.099	0.179	NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens OX=9606 GN=NEK8 PE=1 SV=1
17	Q91ZR4	8.52e-70	251	698	0.098	0.176	NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus OX=10090 GN=Nek8 PE=1 SV=1
18	Q90XC2	7.50e-69	248	697	0.099	0.178	NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio OX=7955 GN=nek8 PE=2 SV=1
19	Q6ZEZ5	9.60e-64	230	585	0.084	0.181	NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica OX=39947 GN=NEK3 PE=1 SV=1
20	Q8TD19	2.60e-63	236	979	0.087	0.112	NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.018	25.7	ABC1 atypical kinase-like domain
2	PF01636 APH	2	19.8	Phosphotransferase enzyme family
3	PF14531 Kinase-like	0.016	26.2	Kinase-like
4	PF00069 Pkinase	8e-65	230.4	Protein kinase domain
5	PF17667 Pkinase_fungal	46	14.2	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	1.4e-40	150.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000028467

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000013851	0.791	Uncharacterized protein
2	9598.ENSPTRP00000034924	0.749	Transmembrane protein 67
3	9598.ENSPTRP00000021140	0.711	Uncharacterized protein
4	9598.ENSPTRP00000057387	0.703	Uncharacterized protein
5	9598.ENSPTRP00000009954	0.692	Uncharacterized protein
6	9598.ENSPTRP00000024055	0.689	Chromosome 21 open reading frame 2
7	9598.ENSPTRP00000026546	0.686	Uncharacterized protein
8	9598.ENSPTRP00000000126	0.679	Centrosomal protein 104kDa
9	9598.ENSPTRP00000043646	0.673	GLIS family zinc finger 2
10	9598.ENSPTRP00000026346	0.667	IQ motif containing B1
11	9598.ENSPTRP00000020154	0.653	Kinesin-like protein
12	9598.ENSPTRP00000023200	0.650	Intraflagellar transport 52 homolog
13	9598.ENSPTRP00000015210	0.647	Uncharacterized protein
14	9598.ENSPTRP00000026210	0.642	Intraflagellar transport 57 homolog
15	9598.ENSPTRP00000022932	0.641	Kinesin-like protein
16	9598.ENSPTRP00000000505	0.640	Kinesin-like protein
17	9598.ENSPTRP00000021899	0.614	May act as a GTPase regulator. Controls survival and growth of spinal motoneurons (By similarity)
18	9598.ENSPTRP00000027791	0.601	Uncharacterized protein
19	9598.ENSPTRP00000056536	0.600	Kinesin-like protein KIF3A
20	9598.ENSPTRP00000036212	0.570	Inversin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0004674	0.856	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0016043	0.967	cellular component organization
GO:0044237	0.944	cellular metabolic process
GO:0044782	0.929	cilium organization
GO:0071704	0.913	organic substance metabolic process
GO:0120031	0.879	plasma membrane bounded cell projection assembly
GO:0043170	0.851	macromolecule metabolic process
GO:1901564	0.845	organonitrogen compound metabolic process
GO:0070925	0.832	organelle assembly
GO:0044238	0.822	primary metabolic process
GO:0065007	0.767	biological regulation
GO:0050794	0.755	regulation of cellular process
GO:0019538	0.731	protein metabolic process
GO:0006796	0.706	phosphate-containing compound metabolic process
GO:0043412	0.695	macromolecule modification
GO:0060271	0.648	cilium assembly
GO:0016310	0.620	phosphorylation
GO:0006468	0.580	protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005815	1.000	microtubule organizing center
GO:0005737	0.998	cytoplasm
GO:0005654	0.995	nucleoplasm
GO:0005813	0.993	centrosome
GO:0005829	0.971	cytosol
GO:0120025	0.789	plasma membrane bounded cell projection
GO:0000242	0.380	pericentriolar material
GO:0034451	0.363	centriolar satellite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]