StarFunc result for job id Q96PZ0

User Input

>input (661 residues)
MEMTEMTGVSLKRGALVVEDNDSGVPVEETKKQKLSECSLTKGQDGLQNDFLSISEDVPR
PPDTVSTGKGGKNSEAQLEDEEEEEEDGLSEECEEEESESFADMMKHGLTEADVGITKFV
SSHQGFSGILKERYSDFVVHEIGKDGRISHLNDLSIPVDEEDPSEDIFTVLTAEEKQRLE
ELQLFKNKETSVAIEVIEDTKEKRTIIHQAIKSLFPGLETKTEDREGKKYIVAYHAAGKK
ALANPRKHSWPKSRGSYCHFVLYKENKDTMDAINVLSKYLRVKPNIFSYMGTKDKRAITV
QEIAVLKITAQRLAHLNKCLMNFKLGNFSYQKNPLKLGELQGNHFTVVLRNITGTDDQVQ
QAMNSLKEIGFINYYGMQRFGTTAVPTYQVGRAILQNSWTEVMDLILKPRSGAEKGYLVK
CREEWAKTKDPTAALRKLPVKRCVEGQLLRGLSKYGMKNIVSAFGIIPRNNRLMYIHSYQ
SYVWNNMVSKRIEDYGLKPVPGDLVLKGATATYIEEDDVNNYSIHDVVMPLPGFDVIYPK
HKIQEAYREMLTADNLDIDNMRHKIRDYSLSGAYRKIIIRPQNVSWEVVAYDDPKIPLFN
TDVDNLEGKTPPVFASEGKYRALKMDFSLPPSTYATMAIREVLKMDTSIKNQTQLNTTWL
R

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96PZ0	1.000	1.000	0.000	661	1.000	1.000	Q96PZ0.pdb.gz	PUS7_HUMAN Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2
2	AFDB:O74343	0.693	0.674	1.665E-55	680	0.357	0.347	O74343.pdb.gz	PUS7_SCHPO Multisubstrate pseudouridine synthase 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pus7 PE=3 SV=1
3	AFDB:Q5XVC2	0.657	0.608	2.504E-55	715	0.343	0.317	Q5XVC2.pdb.gz	Q5XVC2_ARATH Pseudouridine synthase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g04820 PE=1 SV=1
4	AFDB:Q9VSK9	0.695	0.629	2.234E-53	734	0.348	0.313	Q9VSK9.pdb.gz	PUS7_DROME Pseudouridylate synthase 7 homolog OS=Drosophila melanogaster OX=7227 GN=Pus7 PE=1 SV=1
5	AFDB:Q08647	0.647	0.633	4.775E-52	676	0.342	0.334	Q08647.pdb.gz	PUS7_YEAST Multisubstrate pseudouridine synthase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUS7 PE=1 SV=1
6	PDB:7mzvA	0.612	0.689	2.605E-46	583	0.315	0.357	7mzvA.pdb.gz
7	AFDB:Q9H0K6	0.573	0.542	1.437E-39	701	0.253	0.238	Q9H0K6.pdb.gz	PUS7L_HUMAN Pseudouridylate synthase PUS7L OS=Homo sapiens OX=9606 GN=PUS7L PE=1 SV=1
8	AFDB:Q38A69	0.632	0.611	1.635E-35	685	0.247	0.238	Q38A69.pdb.gz	Q38A69_TRYB2 TRUD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1380 PE=3 SV=1
9	AFDB:Q381B8	0.475	0.470	2.715E-26	669	0.182	0.179	Q381B8.pdb.gz	Q381B8_TRYB2 TRUD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8410 PE=3 SV=1
10	PDB:6yxxED	0.541	0.591	1.670E-23	598	0.153	0.169	6yxxED.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
11	PDB:1sb7B	0.372	0.672	1.706E-18	344	0.113	0.218	1sb7B.pdb.gz
12	AFDB:Q57261	0.369	0.661	2.587E-18	349	0.113	0.215	Q57261.pdb.gz	TRUD_ECOLI tRNA pseudouridine synthase D OS=Escherichia coli (strain K12) OX=83333 GN=truD PE=1 SV=1
13	AFDB:Q5U5Q3	0.064	0.064	1.402E-1	659	0.089	0.090	Q5U5Q3.pdb.gz	MEX3C_HUMAN RNA-binding E3 ubiquitin-protein ligase MEX3C OS=Homo sapiens OX=9606 GN=MEX3C PE=1 SV=3
14	PDB:3jcex	0.107	0.115	2.316E-1	586	0.030	0.034	3jcex.pdb.gz	EF4 disengages the peptidyl-tRNA CCA end and facilitates back-translocation on the 70S ribosome
15	PDB:1mowA	0.064	0.156	2.841E-1	248	0.045	0.121	1mowA.pdb.gz	Design, Activity and Structure of a Highly Specific Artificial Endonuclease
16	PDB:2f1fA	0.074	0.210	3.146E-1	163	0.027	0.110	2f1fA.pdb.gz
17	PDB:2iewA	0.061	0.113	3.484E-1	258	0.047	0.120	2iewA.pdb.gz	Crystal structure of inositol phosphate multikinase 2 and implications for substrate specificity.
18	PDB:4qyzK	0.081	0.254	4.061E-1	152	0.032	0.138	4qyzK.pdb.gz	Structural biology. Crystal structure of a CRISPR RNA-guided surveillance complex bound to a ssDNA target.
19	PDB:7qi4f	0.088	0.272	4.981E-1	157	0.029	0.121	7qi4f.pdb.gz	Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
20	PDB:6pe4A	0.062	0.057	5.241E-1	758	0.071	0.062	6pe4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96PZ0	0.0	1375	661	1.000	1.000	PUS7_HUMAN Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2
2	O74343	1.59e-122	381	680	0.356	0.346	PUS7_SCHPO Multisubstrate pseudouridine synthase 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pus7 PE=3 SV=1
3	Q08647	5.44e-115	361	676	0.345	0.337	PUS7_YEAST Multisubstrate pseudouridine synthase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUS7 PE=1 SV=1
4	Q5XVC2	7.56e-109	346	715	0.345	0.319	Q5XVC2_ARATH Pseudouridine synthase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g04820 PE=1 SV=1
5	Q9VSK9	4.89e-102	329	734	0.337	0.304	PUS7_DROME Pseudouridylate synthase 7 homolog OS=Drosophila melanogaster OX=7227 GN=Pus7 PE=1 SV=1
6	Q9H0K6	1.12e-60	217	701	0.218	0.205	PUS7L_HUMAN Pseudouridylate synthase PUS7L OS=Homo sapiens OX=9606 GN=PUS7L PE=1 SV=1
7	Q38A69	7.92e-46	175	685	0.215	0.207	Q38A69_TRYB2 TRUD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1380 PE=3 SV=1
8	Q381B8	1.54e-16	85.9	669	0.166	0.164	Q381B8_TRYB2 TRUD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8410 PE=3 SV=1
9	Q57261	3.37e-13	73.6	349	0.132	0.249	TRUD_ECOLI tRNA pseudouridine synthase D OS=Escherichia coli (strain K12) OX=83333 GN=truD PE=1 SV=1
10	Q385G9	1.33e-08	60.5	616	0.110	0.119	Q385G9_TRYB2 TRUD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3800 PE=1 SV=1
11	Q4GZ59	2.62e-06	53.5	1523	0.097	0.042	Q4GZ59_TRYB2 TRUD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1600 PE=3 SV=1
12	Q726W1	0.063	38.5	387	0.053	0.090	Q726W1_DESVH Glycosyl transferase, group 1 family protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2995 PE=1 SV=1
13	Q4GYD3	0.70	35.8	1167	0.024	0.014	Q4GYD3_TRYB2 Potassium channel domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4450 PE=4 SV=1
14	Q389B8	1.8	34.3	792	0.098	0.082	Q389B8_TRYB2 TRUD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1490 PE=4 SV=1
15	O27271	1.9	34.3	636	0.035	0.036	O27271_METTH Cleavage and polyadenylation specificity factor OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=MTH_1203 PE=1 SV=1
16	K7EMM4	3.4	32.7	220	0.026	0.077	K7EMM4_HUMAN Transcription factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=2
17	Q64464	3.8	33.1	503	0.039	0.052	CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus OX=10090 GN=Cyp3a13 PE=1 SV=1
18	Q86TW2	4.9	32.7	530	0.029	0.036	ADCK1_HUMAN AarF domain-containing protein kinase 1 OS=Homo sapiens OX=9606 GN=ADCK1 PE=1 SV=2
19	P05183	5.8	32.3	504	0.047	0.062	CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus OX=10116 GN=Cyp3a2 PE=1 SV=2
20	O64483	7.9	32.3	876	0.047	0.035	SIRK_ARATH Senescence-induced receptor-like serine/threonine-protein kinase OS=Arabidopsis thaliana OX=3702 GN=SIRK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01424 R3H	1.1e+02	14.2	R3H domain
2	PF01142 TruD	3.2e-70	248.7	tRNA pseudouridine synthase D (TruD)
3	PF12813 XPG_I_2	1.4e+02	13.3	XPG domain containing

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348722

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298746	0.947	Probable tRNA pseudouridine synthase 1
2	9606.ENSP00000365837	0.938	tRNA pseudouridine synthase A
3	9606.ENSP00000358563	0.926	H/ACA ribonucleoprotein complex subunit 4
4	9606.ENSP00000264670	0.925	tRNA (cytosine(34)-C(5))-methyltransferase
5	9606.ENSP00000371858	0.891	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
6	9606.ENSP00000227474	0.890	tRNA pseudouridine(38/39) synthase
7	9606.ENSP00000323288	0.888	RNA pseudouridylate synthase domain containing 2
8	9606.ENSP00000261015	0.873	Ribosome biogenesis protein WDR12
9	9606.ENSP00000326948	0.863	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase
10	9606.ENSP00000265245	0.858	Large subunit GTPase 1 homolog
11	9606.ENSP00000419004	0.858	60S ribosomal export protein NMD3
12	9606.ENSP00000338862	0.851	Ribosome biogenesis protein BRX1 homolog
13	9606.ENSP00000360412	0.845	Nucleolar complex protein 3 homolog
14	9606.ENSP00000223073	0.843	RNA-binding protein 28
15	9606.ENSP00000257829	0.842	RNA cytidine acetyltransferase
16	9606.ENSP00000326003	0.842	Putative tRNA pseudouridine synthase Pus10
17	9606.ENSP00000423067	0.839	WD repeat-containing protein 36
18	9606.ENSP00000354040	0.836	Nucleolar GTP-binding protein 1
19	9606.ENSP00000253237	0.833	Glutamate-rich WD repeat-containing protein 1
20	9606.ENSP00000263239	0.833	ATP-dependent RNA helicase DDX18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0009982	1.000	pseudouridine synthase activity
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0090304	0.989	nucleic acid metabolic process
GO:0050789	0.986	regulation of biological process
GO:0016556	0.981	mRNA modification
GO:0008033	0.979	tRNA processing
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0006400	0.973	tRNA modification
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0080090	0.964	regulation of primary metabolic process
GO:0050794	0.959	regulation of cellular process
GO:0031323	0.946	regulation of cellular metabolic process
GO:0010468	0.946	regulation of gene expression
GO:0031326	0.874	regulation of cellular biosynthetic process
GO:0010556	0.873	regulation of macromolecule biosynthetic process
GO:0001522	0.776	pseudouridine synthesis
GO:2000112	0.631	regulation of cellular macromolecule biosynthetic process
GO:0034248	0.627	regulation of amide metabolic process
GO:0010608	0.535	post-transcriptional regulation of gene expression
GO:0051246	0.535	regulation of protein metabolic process
GO:0010558	0.494	negative regulation of macromolecule biosynthetic process
GO:0031327	0.481	negative regulation of cellular biosynthetic process
GO:0051172	0.466	negative regulation of nitrogen compound metabolic process
GO:0051248	0.427	negative regulation of protein metabolic process
GO:0045595	0.419	regulation of cell differentiation
GO:0006417	0.406	regulation of translation
GO:0010629	0.377	negative regulation of gene expression
GO:2000736	0.365	regulation of stem cell differentiation
GO:1901532	0.365	regulation of hematopoietic progenitor cell differentiation
GO:1902036	0.362	regulation of hematopoietic stem cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.971	nuclear lumen
GO:0005654	0.957	nucleoplasm
GO:0043232	0.939	intracellular non-membrane-bounded organelle
GO:0005737	0.458	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.4.-.-	1.000	Intramolecular transferases.

[back to server]