StarFunc result for job id Q96PZ7

User Input

>input (1400 residues)
MTAWRRFQSLLLLLGLLVLCARLLTAAKGQNCGGLVQGPNGTIESPGFPHGYPNYANCTW
IIITGERNRIQLSFHTFALEEDFDILSVYDGQPQQGNLKVRLSGFQLPSSIVSTGSILTL
WFTTDFAVSAQGFKALYEVLPSHTCGNPGEILKGVLHGTRFNIGDKIRYSCLPGYILEGH
AILTCIVSPGNGASWDFPAPFCRAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILA
EPGDTIALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNH
RRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSVLSQGGVALVSDMCPDPGIPENGRR
AGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWSDHRPICRARTCGSNLRGPSG
VITSPNYPVQYEDNAHCVWVITTTDPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSV
LYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFKAVYQEIEKGGCGDPGIPAYGKRTG
SSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNY
PEEYGNNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVP
SQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECHDPGIPINGRRFGDRFLLGSSVS
FHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKD
SLHCEWIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLIST
GNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDPGIPVNGHRHGGDFGIRSTVTFSCD
PGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTI
EVSHGKGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQL
RFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRRIGFHFGVGDSLTFSCFLGYRLEGA
TKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGK
GIHLRTRSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSD
TDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFTDTVVLYSCNPGYAMHGSNTLTCLS
GDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHF
IVFDTEMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFS
IQFSTSIAATCNDPGMPQNG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43897	0.124	0.162	1.314E-50	1013	0.142	0.196	O43897.pdb.gz	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
2	AFDB:O57460	0.116	0.141	4.638E-50	1022	0.144	0.197	O57460.pdb.gz	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
3	AFDB:Q8JI28	0.156	0.207	9.713E-50	1007	0.141	0.197	Q8JI28.pdb.gz	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
4	AFDB:P98063	0.097	0.129	1.207E-49	991	0.145	0.205	P98063.pdb.gz	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
5	AFDB:E7EXI2	0.191	0.283	3.148E-48	898	0.149	0.233	E7EXI2.pdb.gz
6	AFDB:A0A2R8QEK5	0.131	0.172	3.434E-48	986	0.138	0.196	A0A2R8QEK5.pdb.gz
7	AFDB:Q9Y6L7	0.113	0.131	3.434E-48	1015	0.139	0.192	Q9Y6L7.pdb.gz	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
8	AFDB:Q53EL9	0.192	0.260	8.212E-47	994	0.146	0.206	Q53EL9.pdb.gz	SEZ6_HUMAN Seizure protein 6 homolog OS=Homo sapiens OX=9606 GN=SEZ6 PE=1 SV=2
9	AFDB:Q6P1D5	0.188	0.264	1.796E-46	963	0.142	0.207	Q6P1D5.pdb.gz	SE6L1_MOUSE Seizure 6-like protein OS=Mus musculus OX=10090 GN=Sez6l PE=1 SV=1
10	AFDB:Q9BYH1	0.190	0.252	2.543E-46	1024	0.147	0.201	Q9BYH1.pdb.gz	SE6L1_HUMAN Seizure 6-like protein OS=Homo sapiens OX=9606 GN=SEZ6L PE=1 SV=1
11	PDB:2gsxA	0.074	0.099	1.820E-26	951	0.146	0.215	2gsxA.pdb.gz
12	PDB:2q7zA	0.071	0.057	7.982E-26	1931	0.151	0.110	2q7zA.pdb.gz
13	PDB:1haqA	0.064	0.072	2.308E-16	1213	0.132	0.153	1haqA.pdb.gz
14	PDB:4bxsV	0.056	0.060	4.285E-11	1262	0.089	0.098	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
15	PDB:8a7eC	0.072	0.070	8.260E-9	1524	0.081	0.074	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:7kveB	0.057	0.058	2.559E-8	1374	0.100	0.102	7kveB.pdb.gz
17	PDB:1c1zA	0.048	0.176	5.845E-8	326	0.054	0.233	1c1zA.pdb.gz
18	PDB:7b01A	0.067	0.152	3.051E-7	588	0.034	0.080	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
19	PDB:5n4lA	0.053	0.065	2.159E-6	1034	0.071	0.096	5n4lA.pdb.gz	Rat ceruloplasmin: a new labile copper binding site and zinc/copper mosaic.
20	PDB:1kcwA	0.059	0.068	5.380E-6	1017	0.074	0.101	1kcwA.pdb.gz	The X-ray structure of human serum ceruloplasmin at 3.1 angstrom: Nature of the copper centres.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80T79	0.0	1627	3707	0.531	0.201	CSMD3_MOUSE CUB and sushi domain-containing protein 3 OS=Mus musculus OX=10090 GN=Csmd3 PE=1 SV=3
2	Q923L3	0.0	2763	3564	0.954	0.375	CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus OX=10090 GN=Csmd1 PE=1 SV=2
3	Q96PZ7	0.0	2884	3564	1.000	0.393	CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CSMD1 PE=1 SV=3
4	F1REM3	3.65e-53	205	976	0.104	0.149	F1REM3_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=4 SV=2
5	O43897	5.51e-53	205	1013	0.134	0.186	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
6	Q9BYH1	3.33e-52	202	1024	0.138	0.188	SE6L1_HUMAN Seizure 6-like protein OS=Homo sapiens OX=9606 GN=SEZ6L PE=1 SV=1
7	Q2ABP1	6.76e-52	201	986	0.104	0.147	Q2ABP1_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=2 SV=1
8	Q8JI28	1.34e-51	201	1007	0.097	0.135	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
9	P98063	1.58e-51	200	991	0.099	0.139	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
10	F1M798	2.12e-51	200	990	0.099	0.139	F1M798_RAT Metalloendopeptidase OS=Rattus norvegicus OX=10116 GN=Bmp1 PE=4 SV=2
11	O57460	2.59e-51	200	1022	0.099	0.136	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
12	Q62381	5.08e-51	199	1013	0.130	0.180	TLL1_MOUSE Tolloid-like protein 1 OS=Mus musculus OX=10090 GN=Tll1 PE=1 SV=1
13	P13497	1.12e-50	197	986	0.098	0.139	BMP1_HUMAN Bone morphogenetic protein 1 OS=Homo sapiens OX=9606 GN=BMP1 PE=1 SV=2
14	Q9WVM6	1.46e-50	197	1012	0.124	0.172	TLL2_MOUSE Tolloid-like protein 2 OS=Mus musculus OX=10090 GN=Tll2 PE=1 SV=1
15	Q9Y6L7	2.57e-50	197	1015	0.098	0.135	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
16	Q7TSK2	4.41e-50	196	991	0.112	0.158	SEZ6_MOUSE Seizure protein 6 OS=Mus musculus OX=10090 GN=Sez6 PE=1 SV=1
17	Q6P1D5	2.70e-49	193	963	0.137	0.199	SE6L1_MOUSE Seizure 6-like protein OS=Mus musculus OX=10090 GN=Sez6l PE=1 SV=1
18	Q53EL9	7.14e-48	189	994	0.109	0.154	SEZ6_HUMAN Seizure protein 6 homolog OS=Homo sapiens OX=9606 GN=SEZ6 PE=1 SV=2
19	O60494	9.84e-48	191	3623	0.204	0.079	CUBN_HUMAN Cubilin OS=Homo sapiens OX=9606 GN=CUBN PE=1 SV=5
20	Q9TU53	1.76e-46	186	3620	0.225	0.087	CUBN_CANLF Cubilin OS=Canis lupus familiaris OX=9615 GN=CUBN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	8.6e-185	613.6	CUB domain
2	PF08140 Cuticle_1	9.8e+02	11.2	Crustacean cuticle protein repeat
3	PF00084 Sushi	5.2e-60	211.1	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000430733

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414721	0.721	WW domain binding protein 1 like
2	9606.ENSP00000382104	0.719	Protein dopey-2
3	9606.ENSP00000436785	0.712	Solute carrier family 35 member F2
4	9606.ENSP00000382178	0.681	MAM domain-containing glycosylphosphatidylinositol anchor protein 2
5	9606.ENSP00000303252	0.678	Zinc finger protein 804A
6	9606.ENSP00000355260	0.659	Protein phosphatase 1 regulatory subunit 14C
7	9606.ENSP00000370593	0.654	Receptor-type tyrosine-protein phosphatase delta
8	9606.ENSP00000424226	0.574	Teneurin-3
9	9606.ENSP00000266376	0.557	Voltage-dependent L-type calcium channel subunit alpha-1C
10	9606.ENSP00000466690	0.556	Coiled-coil domain-containing protein 68
11	9606.ENSP00000358894	0.551	Metal transporter CNNM2
12	9606.ENSP00000404705	0.538	Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2
13	9606.ENSP00000479365	0.535	Heterogeneous nuclear ribonucleoprotein C-like 1
14	9606.ENSP00000263925	0.531	E3 ubiquitin-protein ligase LNX
15	9606.ENSP00000299847	0.524	CHRNA7-FAM7A fusion protein
16	9606.ENSP00000384193	0.522	Cell adhesion molecule 2
17	9606.ENSP00000294725	0.514	Potassium channel subfamily T member 2
18	9606.ENSP00000309117	0.513	RNA binding protein fox-1 homolog 1
19	9606.ENSP00000371512	0.505	Zeta-sarcoglycan
20	9606.ENSP00000437554	0.502	IQ motif and SEC7 domain-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.848	developmental process
GO:0032501	0.677	multicellular organismal process
GO:0048856	0.507	anatomical structure development
GO:0007275	0.368	multicellular organism development
GO:0065007	0.351	biological regulation
GO:0050789	0.332	regulation of biological process
GO:0048731	0.307	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005886	0.985	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]