StarFunc result for job id Q96Q04

User Input

>input (1460 residues)
MPAPGALILLAAVSASGCLASPAHPDGFALGRAPLAPPYAVVLISCSGLLAFIFLLLTCL
CCKRGDVGFKEFENPEGEDCSGEYTPPAEETSSSQSLPDVYILPLAEVSLPMPAPQPSHS
DMTTPLGLSRQHLSYLQEIGSGWFGKVILGEIFSDYTPAQVVVKELRASAGPLEQRKFIS
EAQPYRSLQHPNVLQCLGLCVETLPFLLIMEFCQLGDLKRYLRAQRPPEGLSPELPPRDL
RTLQRMGLEIARGLAHLHSHNYVHSDLALRNCLLTSDLTVRIGDYGLAHSNYKEDYYLTP
ERLWIPLRWAAPELLGELHGTFMVVDQSRESNIWSLGVTLWELFEFGAQPYRHLSDEEVL
AFVVRQQHVKLARPRLKLPYADYWYDILQSCWRPPAQRPSASDLQLQLTYLLSERPPRPP
PPPPPPRDGPFPWPWPPAHSAPRPGTLSSPFPLLDGFPGADPDDVLTVTESSRGLNLECL
WEKARRGAGRGGGAPAWQPASAPPAPHANPSNPFYEALSTPSVLPVISARSPSVSSEYYI
RLEEHGSPPEPLFPNDWDPLDPGVPAPQAPQAPSEVPQLVSETWASPLFPAPRPFPAQSS
ASGSFLLSGWDPEGRGAGETLAGDPAEVLGERGTAPWVEEEEEEEEGSSPGEDSSSLGGG
PSRRGPLPCPLCSREGACSCLPLERGDAVAGWGGHPALGCPHPPEDDSSLRAERGSLADL
PMAPPASAPPEFLDPLMGAAAPQYPGRGPPPAPPPPPPPPRAPADPAASPDPPSAVASPG
SGLSSPGPKPGDSGYETETPFSPEGAFPGGGAAEEEGVPRPRAPPEPPDPGAPRPPPDPG
PLPLPGPREKPTFVVQVSTEQLLMSLREDVTRNLLGEKGATARETGPRKAGRGPGNREKV
PGLNRDPTVLGNGKQAPSLSLPVNGVTVLENGDQRAPGIEEKAAENGALGSPEREEKVLE
NGELTPPRREEKALENGELRSPEAGEKVLVNGGLTPPKSEDKVSENGGLRFPRNTERPPE
TGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPK
NGTLEPGTERRAPETGGAPRAPGAGRLDLGSGGRAPVGTGTAPGGGPGSGVDAKAGWVDN
TRPQPPPPPLPPPPEAQPRRLEPAPPRARPEVAPEGEPGAPDSRAGGDTALSGDGDPPKP
ERKGPEMPRLFLDLGPPQGNSEQIKARLSRLSLALPPLTLTPFPGPGPRRPPWEGADAGA
AGGEAGGAGAPGPAEEDGEDEDEDEEEDEEAAAPGAAAGPRGPGRARAAPVPVVVSSADA
DAARPLRGLLKSPRGADEPEDSELERKRKMVSFHGDVTVYLFDQETPTNELSVQAPPEGD
TDPSTPPAPPTPPHPATPGDGFPSNDSGFGGSFEWAEDFPLLPPPGPPLCFSRFSVSPAL
ETPGPPARAPDARPAGPVEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96Q04	1.000	1.000	0.000	1460	1.000	1.000	Q96Q04.pdb.gz	LMTK3_HUMAN Serine/threonine-protein kinase LMTK3 OS=Homo sapiens OX=9606 GN=LMTK3 PE=1 SV=2
2	AFDB:Q6ZMQ8	0.210	0.222	3.495E-54	1374	0.340	0.361	Q6ZMQ8.pdb.gz	LMTK1_HUMAN Serine/threonine-protein kinase LMTK1 OS=Homo sapiens OX=9606 GN=AATK PE=1 SV=2
3	AFDB:Q80YE4	0.211	0.225	1.076E-53	1365	0.325	0.348	Q80YE4.pdb.gz	LMTK1_MOUSE Serine/threonine-protein kinase LMTK1 OS=Mus musculus OX=10090 GN=Aatk PE=1 SV=1
4	AFDB:Q8IWU2	0.202	0.196	1.706E-48	1503	0.286	0.278	Q8IWU2.pdb.gz	LMTK2_HUMAN Serine/threonine-protein kinase LMTK2 OS=Homo sapiens OX=9606 GN=LMTK2 PE=1 SV=2
5	AFDB:D3ZBH5	0.160	0.153	7.132E-37	1531	0.273	0.261	D3ZBH5.pdb.gz	D3ZBH5_RAT Lemur tyrosine kinase 2 OS=Rattus norvegicus OX=10116 GN=Lmtk2 PE=1 SV=2
6	AFDB:P42684	0.159	0.195	7.823E-21	1182	0.121	0.150	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
7	AFDB:A0A024R8E2	0.161	0.204	1.373E-20	1130	0.121	0.157	A0A024R8E2.pdb.gz
8	AFDB:P00522	0.166	0.150	1.536E-20	1620	0.145	0.131	P00522.pdb.gz	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
9	AFDB:F7BN18	0.159	0.204	5.290E-20	1128	0.119	0.154	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
10	AFDB:Q9I7F7	0.173	0.188	1.099E-19	1337	0.146	0.159	Q9I7F7.pdb.gz	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
11	PDB:4fl2A	0.164	0.413	1.467E-19	555	0.058	0.153	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
12	PDB:2h8hA	0.164	0.493	1.943E-19	445	0.058	0.189	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4k2rA	0.161	0.408	6.707E-18	551	0.053	0.140	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:1k9aB	0.157	0.499	1.744E-17	441	0.058	0.190	1k9aB.pdb.gz
15	PDB:1blxA	0.150	0.620	8.455E-15	305	0.053	0.252	1blxA.pdb.gz	Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
16	PDB:4krcA	0.158	0.689	3.858E-14	297	0.047	0.232	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	PDB:1unlA	0.153	0.688	4.081E-14	292	0.044	0.219	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
18	PDB:4btfA	0.150	0.483	4.081E-14	413	0.041	0.145	4btfA.pdb.gz
19	PDB:4eomC	0.154	0.739	5.110E-14	276	0.047	0.250	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:6s73A	0.163	0.784	7.159E-14	269	0.041	0.223	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96Q04	0.0	2825	1460	1.000	1.000	LMTK3_HUMAN Serine/threonine-protein kinase LMTK3 OS=Homo sapiens OX=9606 GN=LMTK3 PE=1 SV=2
2	Q6ZMQ8	1.73e-157	515	1374	0.186	0.197	LMTK1_HUMAN Serine/threonine-protein kinase LMTK1 OS=Homo sapiens OX=9606 GN=AATK PE=1 SV=2
3	Q80YE4	4.12e-156	511	1365	0.186	0.199	LMTK1_MOUSE Serine/threonine-protein kinase LMTK1 OS=Mus musculus OX=10090 GN=Aatk PE=1 SV=1
4	Q8IWU2	2.03e-127	434	1503	0.160	0.156	LMTK2_HUMAN Serine/threonine-protein kinase LMTK2 OS=Homo sapiens OX=9606 GN=LMTK2 PE=1 SV=2
5	D3ZBH5	5.40e-126	432	1631	0.161	0.144	D3ZBH5_RAT Lemur tyrosine kinase 2 OS=Rattus norvegicus OX=10116 GN=Lmtk2 PE=1 SV=2
6	Q6B515	4.03e-44	174	669	0.077	0.167	Q6B515_TAEGU Tyrosine-protein kinase receptor (Fragment) OS=Taeniopygia guttata OX=59729 PE=2 SV=1
7	B7SNG4	3.09e-43	175	1353	0.071	0.076	B7SNG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRa PE=1 SV=1
8	Q05688	5.72e-43	170	640	0.068	0.155	IGF1R_BOVIN Insulin-like growth factor 1 receptor (Fragment) OS=Bos taurus OX=9913 GN=IGF1R PE=2 SV=1
9	Q63604	5.79e-43	172	821	0.077	0.138	NTRK2_RAT BDNF/NT-3 growth factors receptor OS=Rattus norvegicus OX=10116 GN=Ntrk2 PE=1 SV=1
10	Q16620	1.28e-42	171	822	0.077	0.137	NTRK2_HUMAN BDNF/NT-3 growth factors receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=1 SV=1
11	Q548C2	1.28e-42	171	822	0.077	0.137	Q548C2_HUMAN Tyrosine-protein kinase receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=2 SV=1
12	P15209	1.51e-42	171	821	0.071	0.125	NTRK2_MOUSE BDNF/NT-3 growth factors receptor OS=Mus musculus OX=10090 GN=Ntrk2 PE=1 SV=1
13	F7DGW1	1.53e-42	171	838	0.077	0.135	F7DGW1_MACMU Tyrosine-protein kinase receptor OS=Macaca mulatta OX=9544 GN=NTRK2 PE=2 SV=2
14	P35739	2.38e-42	170	799	0.075	0.136	NTRK1_RAT High affinity nerve growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk1 PE=1 SV=1
15	Q3UFB7	3.58e-42	169	799	0.075	0.136	NTRK1_MOUSE High affinity nerve growth factor receptor OS=Mus musculus OX=10090 GN=Ntrk1 PE=1 SV=2
16	I3PGL2	3.83e-42	164	477	0.061	0.187	I3PGL2_BOVIN Tyrosine-protein kinase receptor (Fragment) OS=Bos taurus OX=9913 GN=IGFR1 PE=2 SV=1
17	Q91987	4.96e-42	169	818	0.077	0.138	NTRK2_CHICK BDNF/NT-3 growth factors receptor OS=Gallus gallus OX=9031 GN=NTRK2 PE=1 SV=1
18	Q9PWN6	9.59e-42	169	989	0.070	0.103	Q9PWN6_CHICK Tyrosine-protein kinase receptor (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
19	Q24488	1.23e-41	166	685	0.066	0.140	ROR1_DROME Tyrosine-protein kinase transmembrane receptor Ror OS=Drosophila melanogaster OX=7227 GN=Ror PE=1 SV=1
20	Q16832	1.81e-41	167	855	0.068	0.117	DDR2_HUMAN Discoidin domain-containing receptor 2 OS=Homo sapiens OX=9606 GN=DDR2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	4.1e-28	110.1	Protein kinase domain
2	PF07714 PK_Tyr_Ser-Thr	1.6e-58	209.6	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000270238

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405330	0.525	Estrogen receptor
2	9606.ENSP00000358953	0.511	CUE domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016301	0.915	kinase activity
GO:0140096	0.892	catalytic activity, acting on a protein
GO:0004672	0.876	protein kinase activity
GO:0004674	0.384	protein serine/threonine kinase activity
GO:0038023	0.308	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0044237	0.819	cellular metabolic process
GO:0071704	0.801	organic substance metabolic process
GO:0044238	0.782	primary metabolic process
GO:0006807	0.717	nitrogen compound metabolic process
GO:0043170	0.699	macromolecule metabolic process
GO:0050896	0.683	response to stimulus
GO:1901564	0.658	organonitrogen compound metabolic process
GO:0019538	0.636	protein metabolic process
GO:0007154	0.632	cell communication
GO:0051716	0.621	cellular response to stimulus
GO:0006793	0.613	phosphorus metabolic process
GO:0036211	0.605	protein modification process
GO:0023052	0.604	signaling
GO:0007165	0.503	signal transduction
GO:0019222	0.438	regulation of metabolic process
GO:0060255	0.340	regulation of macromolecule metabolic process
GO:0031323	0.327	regulation of cellular metabolic process
GO:0006796	0.326	phosphate-containing compound metabolic process
GO:0080090	0.322	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005886	0.993	plasma membrane
GO:0005622	0.949	intracellular anatomical structure
GO:0031981	0.936	nuclear lumen
GO:0005654	0.927	nucleoplasm
GO:0005829	0.888	cytosol
GO:0012505	0.623	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.-.-	0.915	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.876	Phosphotransferases with an alcohol group as acceptor.

[back to server]