StarFunc result for job id Q96Q05

User Input

>input (1148 residues)
MSVPDYMQCAEDHQTLLVVVQPVGIVSEENFFRIYKRICSVSQISVRDSQRVLYIRYRHH
YPPENNEWGDFQTHRKVVGLITITDCFSAKDWPQTFEKFHVQKEIYGSTLYDSRLFVFGL
QGEIVEQPRTDVAFYPNYEDCQTVEKRIEDFIESLFIVLESKRLDRATDKSGDKIPLLCV
PFEKKDFVGLDTDSRHYKKRCQGRMRKHVGDLCLQAGMLQDSLVHYHMSVELLRSVNDFL
WLGAALEGLCSASVIYHYPGGTGGKSGARRFQGSTLPAEAANRHRPGAQEVLIDPGALTT
NGINPDTSTEIGRAKNCLSPEDIIDKYKEAISYYSKYKNAGVIELEACIKAVRVLAIQKR
SMEASEFLQNAVYINLRQLSEEEKIQRYSILSELYELIGFHRKSAFFKRVAAMQCVAPSI
AEPGWRACYKLLLETLPGYSLSLDPKDFSRGTHRGWAAVQMRLLHELVYASRRMGNPALS
VRHLSFLLQTMLDFLSDQEKKDVAQSLENYTSKCPGTMEPIALPGGLTLPPVPFTKLPIV
RHVKLLNLPASLRPHKMKSLLGQNVSTKSPFIYSPIIAHNRGEERNKKIDFQWVQGDVCE
VQLMVYNPMPFELRVENMGLLTSGVEFESLPAALSLPAESGLYPVTLVGVPQTTGTITVN
GYHTTVFGVFSDCLLDNLPGIKTSGSTVEVIPALPRLQISTSLPRSAHSLQPSSGDEIST
NVSVQLYNGESQQLIIKLENIGMEPLEKLEVTSKVLTTKEKLYGDFLSWKLEETLAQFPL
QPGKVATFTINIKVKLDFSCQENLLQDLSDDGISVSGFPLSSPFRQVVRPRVEGKPVNPP
ESNKAGDYSHVKTLEAVLNFKYSGGPGHTEGYYRNLSLGLHVEVEPSVFFTRVSTLPATS
TRQCHLLLDVFNSTEHELTVSTRSSEALILHAGECQRMAIQVDKFNFESFPESPGEKGQF
ANPKQLEEERREARGLEIHSKLGICWRIPSLKRSGEASVEGLLNQLVLEHLQLAPLQWDV
LVDGQPCDREAVAACQVGDPVRLEVRLTNRSPRSVGPFALTVVPFQDHQNGVHNYDLHDT
VSFVGSSTFYLDAVQPSGQSACLGALLFLYTGDFFLHIRFHEDSTSKELPPSWFCLPSVH
VCALEAQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3U0M1	0.922	0.922	0.000	1148	0.926	0.926	Q3U0M1.pdb.gz	TPPC9_MOUSE Trafficking protein particle complex subunit 9 OS=Mus musculus OX=10090 GN=Trappc9 PE=1 SV=2
2	AFDB:Q9VIL0	0.766	0.675	2.218E-99	1320	0.348	0.302	Q9VIL0.pdb.gz	BRUN_DROME Protein brunelleschi OS=Drosophila melanogaster OX=7227 GN=brun PE=1 SV=2
3	AFDB:Q9FY61	0.517	0.504	1.839E-57	1186	0.214	0.207	Q9FY61.pdb.gz	TR120_ARATH Trafficking protein particle complex II-specific subunit 120 homolog OS=Arabidopsis thaliana OX=3702 GN=TRS120 PE=1 SV=1
4	AFDB:Q04183	0.320	0.290	2.868E-46	1289	0.171	0.152	Q04183.pdb.gz	TR120_YEAST Trafficking protein particle complex II-specific subunit 120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRS120 PE=1 SV=1
5	AFDB:O14251	0.530	0.507	8.113E-44	1210	0.164	0.155	O14251.pdb.gz	TR120_SCHPO Transport protein particle subunit trs120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trs120 PE=3 SV=1
6	PDB:7u05A	0.496	0.508	7.693E-42	1114	0.152	0.157	7u05A.pdb.gz
7	AFDB:Q9Y2L5	0.406	0.342	1.914E-28	1435	0.155	0.124	Q9Y2L5.pdb.gz	TPPC8_HUMAN Trafficking protein particle complex subunit 8 OS=Homo sapiens OX=9606 GN=TRAPPC8 PE=1 SV=2
8	AFDB:Q9VW22	0.369	0.331	3.740E-26	1319	0.126	0.110	Q9VW22.pdb.gz	Q9VW22_DROME FI18195p1 OS=Drosophila melanogaster OX=7227 GN=l(3)76BDm PE=1 SV=2
9	AFDB:Q7Z392	0.248	0.251	2.000E-24	1133	0.113	0.115	Q7Z392.pdb.gz	TPC11_HUMAN Trafficking protein particle complex subunit 11 OS=Homo sapiens OX=9606 GN=TRAPPC11 PE=1 SV=2
10	AFDB:Q1RLX4	0.254	0.257	4.600E-24	1132	0.115	0.117	Q1RLX4.pdb.gz	TPC11_DANRE Trafficking protein particle complex subunit 11 OS=Danio rerio OX=7955 GN=trappc11 PE=2 SV=1
11	AFDB:P48553	0.178	0.164	8.395E-24	1259	0.123	0.112	P48553.pdb.gz	TPC10_HUMAN Trafficking protein particle complex subunit 10 OS=Homo sapiens OX=9606 GN=TRAPPC10 PE=1 SV=2
12	PDB:7ea3J	0.327	0.390	7.238E-18	883	0.107	0.139	7ea3J.pdb.gz
13	PDB:7u05B	0.168	0.204	5.793E-13	815	0.084	0.119	7u05B.pdb.gz
14	PDB:7sqcO0	0.165	0.166	9.959E-10	1140	0.062	0.062	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:5a42A	0.120	0.091	9.382E-7	1597	0.064	0.046	5a42A.pdb.gz
16	PDB:4rtdA	0.112	0.114	2.367E-6	1122	0.051	0.052	4rtdA.pdb.gz
17	PDB:7sqcO1	0.108	0.157	3.272E-6	673	0.086	0.147	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:3k6sC	0.076	0.096	4.319E-6	885	0.053	0.069	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
19	PDB:4ziqA	0.114	0.094	7.882E-6	1450	0.064	0.051	4ziqA.pdb.gz
20	PDB:4lnvB	0.099	0.106	1.141E-5	1063	0.045	0.049	4lnvB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AB20	0.0	1835	960	0.769	0.920	A0A8I6AB20_RAT Trafficking protein particle complex subunit 9 OS=Rattus norvegicus OX=10116 GN=Trappc9 PE=1 SV=1
2	A0A8I6AL85	0.0	1643	873	0.690	0.907	A0A8I6AL85_RAT Trafficking protein particle complex subunit 9 OS=Rattus norvegicus OX=10116 GN=Trappc9 PE=1 SV=1
3	A0A8I6AP83	0.0	1542	869	0.656	0.867	A0A8I6AP83_RAT Trafficking protein particle complex subunit 9 OS=Rattus norvegicus OX=10116 GN=Trappc9 PE=1 SV=1
4	A0A8I6GM01	0.0	1542	869	0.658	0.869	A0A8I6GM01_RAT Trafficking protein particle complex subunit 9 OS=Rattus norvegicus OX=10116 GN=Trappc9 PE=1 SV=1
5	D3ZJK6	0.0	1667	925	0.694	0.862	D3ZJK6_RAT Trafficking protein particle complex subunit 9 OS=Rattus norvegicus OX=10116 GN=Trappc9 PE=1 SV=3
6	E9PU02	0.0	2196	1139	0.920	0.927	E9PU02_RAT Trafficking protein particle complex subunit 9 OS=Rattus norvegicus OX=10116 GN=Trappc9 PE=1 SV=4
7	Q32PH0	0.0	2172	1138	0.916	0.924	TPPC9_BOVIN Trafficking protein particle complex subunit 9 OS=Bos taurus OX=9913 GN=TRAPPC9 PE=1 SV=1
8	Q3U0M1	0.0	2220	1148	0.927	0.927	TPPC9_MOUSE Trafficking protein particle complex subunit 9 OS=Mus musculus OX=10090 GN=Trappc9 PE=1 SV=2
9	Q96Q05	0.0	2378	1148	1.000	1.000	TPPC9_HUMAN Trafficking protein particle complex subunit 9 OS=Homo sapiens OX=9606 GN=TRAPPC9 PE=1 SV=2
10	Q9VIL0	5.07e-121	407	1320	0.240	0.208	BRUN_DROME Protein brunelleschi OS=Drosophila melanogaster OX=7227 GN=brun PE=1 SV=2
11	Q9FY61	8.02e-36	150	1186	0.151	0.146	TR120_ARATH Trafficking protein particle complex II-specific subunit 120 homolog OS=Arabidopsis thaliana OX=3702 GN=TRS120 PE=1 SV=1
12	C8V0L5	5.96e-07	56.6	1474	0.089	0.069	C8V0L5_EMENI Hypercellular protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06533 PE=4 SV=1
13	Q04183	6.68e-04	46.6	1289	0.027	0.024	TR120_YEAST Trafficking protein particle complex II-specific subunit 120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRS120 PE=1 SV=1
14	O14251	0.014	42.4	1210	0.017	0.017	TR120_SCHPO Transport protein particle subunit trs120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trs120 PE=3 SV=1
15	Q5AZ32	1.0	36.2	2517	0.024	0.011	PKBA_EMENI Non-reducing polyketide synthase pkbA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkbA PE=1 SV=1
16	Q03973	8.6	32.3	246	0.028	0.130	HMO1_YEAST High mobility group protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HMO1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09373 PMBR	4.2e+02	12.5	Pseudomurein-binding repeat
2	PF08626 TRAPPC9-Trs120	3.1e-46	169.1	Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit
3	PF09454 Vps23_core	1e+02	14.3	Vps23 core domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373979

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000291574	0.999	Trafficking protein particle complex subunit 10
2	9606.ENSP00000392495	0.999	Trafficking protein particle complex subunit 2
3	9606.ENSP00000283351	0.998	Trafficking protein particle complex subunit 8
4	9606.ENSP00000470262	0.998	Trafficking protein particle complex subunit 5
5	9606.ENSP00000480332	0.998	Trafficking protein particle complex subunit 3
6	9606.ENSP00000302783	0.997	Trafficking protein particle complex subunit 1
7	9606.ENSP00000436005	0.997	Trafficking protein particle complex subunit 4
8	9606.ENSP00000006275	0.995	Trafficking protein particle complex subunit 6A
9	9606.ENSP00000330289	0.993	Trafficking protein particle complex subunit 6B
10	9606.ENSP00000357591	0.993	Trafficking protein particle complex subunit 3-like protein
11	9606.ENSP00000301021	0.987	Trafficking protein particle complex subunit 2-like protein
12	9606.ENSP00000324318	0.986	Trafficking protein particle complex subunit 12
13	9606.ENSP00000469888	0.980	Trafficking protein particle complex 2 pseudogene 1
14	9606.ENSP00000335371	0.968	Trafficking protein particle complex subunit 11
15	9606.ENSP00000409231	0.961	Belongs to the TRAPPC13 family
16	9606.ENSP00000387286	0.937	Ras-related protein Rab-1A
17	9606.ENSP00000350386	0.915	Rab proteins geranylgeranyltransferase component A 1
18	9606.ENSP00000394071	0.914	Rab GDP dissociation inhibitor alpha
19	9606.ENSP00000369538	0.904	Rab GDP dissociation inhibitor beta
20	9606.ENSP00000355511	0.902	Rab proteins geranylgeranyltransferase component A 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007399	0.977	nervous system development
GO:0009987	0.940	cellular process
GO:0065007	0.876	biological regulation
GO:0050789	0.848	regulation of biological process
GO:0048513	0.837	animal organ development
GO:0050794	0.797	regulation of cellular process
GO:0007420	0.771	brain development
GO:0021543	0.746	pallium development
GO:0021987	0.682	cerebral cortex development
GO:0019222	0.370	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.987	cytosol
GO:0032991	0.978	protein-containing complex
GO:0012505	0.871	endomembrane system
GO:0043231	0.861	intracellular membrane-bounded organelle
GO:0016020	0.734	membrane
GO:0140535	0.568	intracellular protein-containing complex
GO:0099023	0.480	vesicle tethering complex
GO:0030008	0.470	TRAPP complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]