StarFunc result for job id Q96Q06

User Input

>input (1357 residues)
MQTLGSFFGSLPGFSSARNLVANAHSSARARPAADPTGAPAAEAAQPQAQVAAHPEQTAP
WTEKELQPSEKQMVSGAKDLVCSKMSRAKDAVSSGVASVVDVAKGVVQGGLDTTRSALTG
TKEVVSSGVTGAMDMAKGAVQGGLDTSKAVLTGTKDTVSTGLTGAVNVAKGTVQAGVDTT
KTVLTGTKDTVTTGVMGAVNLAKGTVQTGVETSKAVLTGTKDAVSTGLTGAVNVARGSIQ
TGVDTSKTVLTGTKDTVCSGVTGAMNVAKGTIQTGVDTSKTVLTGTKDTVCSGVTGAMNV
AKGTIQTGVDTSKTVLTGTKDTVCSGVTGAMNVAKGTIQTGVDTTKTVLTGTKNTVCSGV
TGAVNLAKEAIQGGLDTTKSMVMGTKDTMSTGLTGAANVAKGAMQTGLNTTQNIATGTKD
TVCSGVTGAMNLARGTIQTGVDTTKIVLTGTKDTVCSGVTGAANVAKGAVQGGLDTTKSV
LTGTKDAVSTGLTGAVNVAKGTVQTGVDTTKTVLTGTKDTVCSGVTSAVNVAKGAVQGGL
DTTKSVVIGTKDTMSTGLTGAANVAKGAVQTGVDTAKTVLTGTKDTVTTGLVGAVNVAKG
TVQTGMDTTKTVLTGTKDTIYSGVTSAVNVAKGAVQTGLKTTQNIATGTKNTFGSGVTSA
VNVAKGAAQTGVDTAKTVLTGTKDTVTTGLMGAVNVAKGTVQTSVDTTKTVLTGTKDTVC
SGVTGAANVAKGAIQGGLDTTKSVLTGTKDAVSTGLTGAVKLAKGTVQTGMDTTKTVLTG
TKDAVCSGVTGAANVAKGAVQMGVDTAKTVLTGTKDTVCSGVTGAANVAKGAVQTGLKTT
QNIATGTKNTLGSGVTGAAKVAKGAVQGGLDTTKSVLTGTKDAVSTGLTGAVNLAKGTVQ
TGVDTSKTVLTGTKDTVCSGVTGAVNVAKGTVQTGVDTAKTVLSGAKDAVTTGVTGAVNV
AKGTVQTGVDASKAVLMGTKDTVFSGVTGAMSMAKGAVQGGLDTTKTVLTGTKDAVSAGL
MGSGNVATGATHTGLSTFQNWLPSTPATSWGGLTSSRTTDNGGEQTALSPQEAPFSGIST
PPDVLSVGPEPAWEAAATTKGLATDVATFTQGAAPGREDTGLLATTHGPEEAPRLAMLQN
ELEGLGDIFHPMNAEEQAQLAASQPGPKVLSAEQGSYFVRLGDLGPSFRQRAFEHAVSHL
QHGQFQARDTLAQLQDCFRLIEKAQQAPEGQPRLDQGSGASAEDAAVQEERDAGVLSRVC
GLLRQLHTAYSGLVSSLQGLPAELQQPVGRARHSLCELYGIVASAGSVEELPAERLVQSR
EGVHQAWQGLEQLLEGLQHNPPLSWLVGPFALPAGGQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96Q06	1.000	1.000	0.000	1357	1.000	1.000	Q96Q06.pdb.gz	PLIN4_HUMAN Perilipin-4 OS=Homo sapiens OX=9606 GN=PLIN4 PE=1 SV=3
2	AFDB:Q63767	0.092	0.123	9.898E-4	968	0.040	0.056	Q63767.pdb.gz	BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1
3	AFDB:Q86CS2	0.051	0.083	2.031E-3	668	0.032	0.064	Q86CS2.pdb.gz	ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum OX=44689 GN=atg1 PE=3 SV=1
4	AFDB:B1H1X1	0.059	0.096	5.050E-3	673	0.042	0.085	B1H1X1.pdb.gz	FXL17_XENLA F-box/LRR-repeat protein 17 OS=Xenopus laevis OX=8355 GN=fbxl17 PE=2 SV=1
5	AFDB:D3ZW88	0.080	0.079	1.595E-2	1371	0.043	0.042	D3ZW88.pdb.gz	D3ZW88_RAT FERM and PDZ domain containing 1 OS=Rattus norvegicus OX=10116 GN=Frmpd1 PE=4 SV=3
6	AFDB:Q9D709	0.056	0.137	4.365E-2	391	0.037	0.128	Q9D709.pdb.gz	TMM79_MOUSE Transmembrane protein 79 OS=Mus musculus OX=10090 GN=Tmem79 PE=1 SV=1
7	AFDB:Q64355	0.076	0.159	4.804E-2	560	0.044	0.107	Q64355.pdb.gz	EFS_MOUSE Embryonal Fyn-associated substrate OS=Mus musculus OX=10090 GN=Efs PE=1 SV=2
8	AFDB:Q4WLB9	0.031	0.083	6.105E-2	305	0.029	0.131	Q4WLB9.pdb.gz	CFMA_ASPFU GPI-anchored hemophore cfmA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=cfmA PE=1 SV=1
9	AFDB:Q586F2	0.209	0.221	7.050E-2	1242	0.079	0.086	Q586F2.pdb.gz	Q586F2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.300 PE=4 SV=1
10	AFDB:Q8YT39	0.051	0.083	7.050E-2	742	0.049	0.089	Q8YT39.pdb.gz	Q8YT39_NOSS1 Alr2887 protein OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=alr2887 PE=1 SV=1
11	PDB:1ggqA	0.075	0.450	1.248E-1	162	0.015	0.123	1ggqA.pdb.gz
12	PDB:7n8oQ	0.048	0.315	1.441E-1	119	0.017	0.193	7n8oQ.pdb.gz	High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.
13	PDB:6ylgb	0.064	0.125	2.441E-1	613	0.013	0.029	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
14	PDB:4eukB	0.048	0.255	2.687E-1	152	0.015	0.138	4eukB.pdb.gz	Structure-Function Analysis of Arabidopsis thaliana Histidine Kinase AHK5 Bound to Its Cognate Phosphotransfer Protein AHP1.
15	PDB:6elzb	0.058	0.151	3.415E-1	421	0.013	0.043	6elzb.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
16	PDB:1y4cA	0.071	0.185	3.582E-1	480	0.021	0.058	1y4cA.pdb.gz	De novo design of an IL-4 antagonist and its structure at 1.9 A.
17	PDB:7ajtUK	0.042	0.125	3.943E-1	242	0.016	0.091	7ajtUK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	PDB:1yviA	0.065	0.503	5.010E-1	140	0.014	0.136	1yviA.pdb.gz
19	PDB:5mx5L	0.058	0.250	5.010E-1	214	0.025	0.159	5mx5L.pdb.gz
20	PDB:5bpwA	0.086	0.163	5.256E-1	659	0.029	0.059	5bpwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0J9YXN7	0.0	2607	1372	0.999	0.988	A0A0J9YXN7_HUMAN Perilipin 4 OS=Homo sapiens OX=9606 GN=PLIN4 PE=1 SV=1
2	O88492	0.0	1456	1403	0.617	0.597	PLIN4_MOUSE Perilipin-4 OS=Mus musculus OX=10090 GN=Plin4 PE=1 SV=2
3	Q96Q06	0.0	2614	1357	1.000	1.000	PLIN4_HUMAN Perilipin-4 OS=Homo sapiens OX=9606 GN=PLIN4 PE=1 SV=3
4	Q9DBG5	2.70e-20	97.8	437	0.047	0.146	PLIN3_MOUSE Perilipin-3 OS=Mus musculus OX=10090 GN=Plin3 PE=1 SV=1
5	A0A140VJN8	2.09e-18	92.0	433	0.057	0.180	A0A140VJN8_HUMAN Perilipin OS=Homo sapiens OX=9606 PE=2 SV=1
6	O60664	3.88e-18	91.3	434	0.055	0.173	PLIN3_HUMAN Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=3
7	Q00G26	1.07e-17	90.1	463	0.063	0.184	PLIN5_HUMAN Perilipin-5 OS=Homo sapiens OX=9606 GN=PLIN5 PE=1 SV=2
8	G5DC08	1.40e-15	83.6	459	0.039	0.115	G5DC08_PIG Perilipin OS=Sus scrofa OX=9823 PE=2 SV=1
9	D0G0B6	2.36e-15	82.8	459	0.039	0.115	D0G0B6_PIG Perilipin OS=Sus scrofa OX=9823 GN=PLIN2 PE=1 SV=1
10	Q4PLW0	2.75e-15	82.4	459	0.038	0.113	PLIN2_PIG Perilipin-2 OS=Sus scrofa OX=9823 GN=PLIN2 PE=2 SV=1
11	R9WDQ0	3.37e-15	82.4	459	0.038	0.113	R9WDQ0_PIG Perilipin OS=Sus scrofa OX=9823 GN=PLIN2 PE=2 SV=1
12	Q9MZE5	1.12e-14	80.5	459	0.038	0.111	Q9MZE5_PIG Perilipin OS=Sus scrofa OX=9823 GN=ADRP PE=2 SV=2
13	Q6FHZ7	2.55e-14	79.3	437	0.040	0.124	Q6FHZ7_HUMAN Perilipin OS=Homo sapiens OX=9606 GN=ADFP PE=2 SV=1
14	Q99541	2.55e-14	79.3	437	0.040	0.124	PLIN2_HUMAN Perilipin-2 OS=Homo sapiens OX=9606 GN=PLIN2 PE=1 SV=2
15	M0R7Z9	9.64e-14	77.8	475	0.052	0.149	PLIN5_RAT Perilipin-5 OS=Rattus norvegicus OX=10116 GN=Plin5 PE=1 SV=1
16	H2FLL1	6.48e-13	76.3	1397	0.153	0.149	H2FLL1_CAEEL Plant Late Embryo Abundant (LEA) related OS=Caenorhabditis elegans OX=6239 GN=lea-1 PE=1 SV=1
17	A0A8I6AJS7	1.11e-11	70.9	399	0.042	0.143	A0A8I6AJS7_RAT Perilipin OS=Rattus norvegicus OX=10116 GN=Plin2 PE=1 SV=1
18	Q8BVZ1	1.11e-11	71.2	463	0.052	0.153	PLIN5_MOUSE Perilipin-5 OS=Mus musculus OX=10090 GN=Plin5 PE=1 SV=1
19	Q5U2U5	3.12e-11	69.7	422	0.042	0.135	Q5U2U5_RAT Perilipin OS=Rattus norvegicus OX=10116 GN=Plin2 PE=1 SV=1
20	K7ERZ3	3.18e-10	65.1	292	0.028	0.130	K7ERZ3_HUMAN Perilipin 3 (Fragment) OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08545 ACP_syn_III	1.1e-07	42.9	3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III
2	PF07340 Herpes_IE1	65	13.9	Cytomegalovirus IE1 protein
3	PF03036 Perilipin	3.8e-84	294.7	Perilipin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301286

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300055	0.858	Perilipin-1
2	9606.ENSP00000373328	0.724	Cell death activator CIDE-3
3	9606.ENSP00000390849	0.685	1-acylglycerol-3-phosphate O-acyltransferase ABHD5
4	9606.ENSP00000337701	0.665	Patatin-like phospholipase domain-containing protein 2
5	9606.ENSP00000244289	0.618	Hormone-sensitive lipase
6	9606.ENSP00000320209	0.544	Cell death activator CIDE-A
7	9606.ENSP00000331845	0.521	Protein PRR14L
8	9606.ENSP00000256104	0.508	Fatty acid-binding protein, adipocyte
9	9606.ENSP00000228027	0.500	Diacylglycerol O-acyltransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.940	cellular process
GO:0050896	0.765	response to stimulus
GO:0065007	0.648	biological regulation
GO:0050789	0.624	regulation of biological process
GO:0008152	0.517	metabolic process
GO:0050794	0.516	regulation of cellular process
GO:0071704	0.509	organic substance metabolic process
GO:0044238	0.481	primary metabolic process
GO:0044237	0.472	cellular metabolic process
GO:0051179	0.453	localization
GO:0009058	0.413	biosynthetic process
GO:0033036	0.404	macromolecule localization
GO:0071840	0.362	cellular component organization or biogenesis
GO:1901576	0.312	organic substance biosynthetic process
GO:0016043	0.309	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005811	0.999	lipid droplet
GO:0005829	0.998	cytosol
GO:0043227	0.634	membrane-bounded organelle
GO:0043231	0.494	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]