StarFunc result for job id Q96Q11

User Input

>input (434 residues)
MLRCLYHWHRPVLNRRWSRLCLPKQYLFTMKLQSPEFQSLFTEGLKSLTELFVKENHELR
IAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENF
EITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKK
VRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWV
ELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLF
KVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATT
RVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGY
QMEKDELLSYIKKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8K1J6	0.903	0.903	2.608E-61	434	0.924	0.924	Q8K1J6.pdb.gz	TRNT1_MOUSE CCA tRNA nucleotidyltransferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Trnt1 PE=1 SV=1
2	PDB:4x4wA	0.826	0.897	1.447E-56	398	0.910	0.992	4x4wA.pdb.gz
3	AFDB:A0A2R8RYZ2	0.947	0.953	2.532E-55	431	0.675	0.680	A0A2R8RYZ2.pdb.gz
4	AFDB:Q7D4M2	0.701	0.640	4.439E-18	480	0.249	0.225	Q7D4M2.pdb.gz	Q7D4M2_MYCTO PolyA polymerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pcnB PE=4 SV=1
5	AFDB:P0ABF1	0.615	0.578	1.810E-16	465	0.212	0.198	P0ABF1.pdb.gz	PCNB_ECOLI Poly(A) polymerase I OS=Escherichia coli (strain K12) OX=83333 GN=pcnB PE=1 SV=2
6	AFDB:Q54BQ2	0.703	0.562	3.793E-15	558	0.217	0.168	Q54BQ2.pdb.gz	Q54BQ2_DICDI Poly A polymerase head domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293504 PE=3 SV=1
7	AFDB:Q9Y7U9	0.670	0.610	5.818E-15	484	0.200	0.180	Q9Y7U9.pdb.gz	CCA2_SCHPO tRNA nucleotidyltransferase cca2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cca2 PE=1 SV=1
8	AFDB:Q94K06	0.684	0.507	1.909E-14	605	0.237	0.170	Q94K06.pdb.gz	Q94K06_ARATH Polynucleotide adenylyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g22660 PE=1 SV=1
9	AFDB:Q9UTQ0	0.657	0.581	2.422E-14	500	0.226	0.196	Q9UTQ0.pdb.gz	CCA1_SCHPO tRNA nucleotidyltransferase cca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cca1 PE=1 SV=2
10	AFDB:Q9P4S5	0.684	0.571	9.166E-14	531	0.256	0.209	Q9P4S5.pdb.gz	CCA1_CANGA CCA tRNA nucleotidyltransferase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CCA1 PE=1 SV=2
11	AFDB:P21269	0.649	0.531	3.155E-13	546	0.240	0.190	P21269.pdb.gz	CCA1_YEAST CCA tRNA nucleotidyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCA1 PE=1 SV=1
12	PDB:3hj1B	0.195	0.212	6.743E-2	387	0.097	0.109	3hj1B.pdb.gz	Structure of the Mitochondrial Editosome-Like Complex Associated TUTase 1 Reveals Divergent Mechanisms of UTP Selection and Domain Organization.
13	PDB:3c66A	0.193	0.166	9.863E-2	529	0.090	0.074	3c66A.pdb.gz	Structure of yeast poly(A) polymerase in complex with a peptide from Fip1, an intrinsically disordered protein.
14	PDB:4e7xD	0.159	0.206	2.434E-1	320	0.041	0.056	4e7xD.pdb.gz
15	PDB:7nsuD	0.063	0.065	3.915E-1	420	0.074	0.076	7nsuD.pdb.gz
16	PDB:6kajA	0.165	0.161	6.604E-1	446	0.037	0.036	6kajA.pdb.gz	Crystal structures of fukutin-related protein (FKRP), a ribitol-phosphate transferase related to muscular dystrophy.
17	PDB:7ohrI	0.124	0.130	6.604E-1	409	0.076	0.081	7ohrI.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
18	PDB:6l4oA	0.167	0.168	7.263E-1	429	0.094	0.096	6l4oA.pdb.gz
19	PDB:3axyC	0.111	0.180	8.784E-1	235	0.071	0.132	3axyC.pdb.gz	14-3-3 proteins act as intracellular receptors for rice Hd3a florigen
20	PDB:6x9oA	0.150	0.041	8.784E-1	2425	0.060	0.011	6x9oA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F6NXI9	0.0	613	431	0.661	0.666	TRNT1_DANRE CCA tRNA nucleotidyltransferase 1, mitochondrial OS=Danio rerio OX=7955 GN=trnt1 PE=2 SV=1
2	Q8K1J6	0.0	834	434	0.926	0.926	TRNT1_MOUSE CCA tRNA nucleotidyltransferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Trnt1 PE=1 SV=1
3	Q96Q11	0.0	899	434	1.000	1.000	TRNT1_HUMAN CCA tRNA nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TRNT1 PE=1 SV=2
4	P0ABF1	2.49e-20	95.1	465	0.161	0.151	PCNB_ECOLI Poly(A) polymerase I OS=Escherichia coli (strain K12) OX=83333 GN=pcnB PE=1 SV=2
5	Q7D4M2	5.55e-20	94.4	480	0.191	0.173	Q7D4M2_MYCTO PolyA polymerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pcnB PE=4 SV=1
6	Q9P4S5	1.46e-13	74.7	531	0.283	0.232	CCA1_CANGA CCA tRNA nucleotidyltransferase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CCA1 PE=1 SV=2
7	F4INK3	4.60e-13	73.6	757	0.184	0.106	F4INK3_ARATH Polynucleotide adenylyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=AGS1 PE=1 SV=1
8	P21269	2.41e-12	70.9	546	0.173	0.137	CCA1_YEAST CCA tRNA nucleotidyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCA1 PE=1 SV=1
9	Q9UTQ0	3.16e-11	67.4	500	0.177	0.154	CCA1_SCHPO tRNA nucleotidyltransferase cca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cca1 PE=1 SV=2
10	Q9M300	6.97e-11	66.6	881	0.122	0.060	Q9M300_ARATH Uncharacterized protein T21J18_100 OS=Arabidopsis thaliana OX=3702 GN=T21J18_100 PE=3 SV=1
11	Q94K06	1.78e-10	65.1	605	0.168	0.121	Q94K06_ARATH Polynucleotide adenylyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g22660 PE=1 SV=1
12	P06961	6.49e-10	63.2	412	0.150	0.158	CCA_ECOLI Multifunctional CCA protein OS=Escherichia coli (strain K12) OX=83333 GN=cca PE=1 SV=1
13	Q9Y7U9	1.91e-09	61.6	484	0.212	0.190	CCA2_SCHPO tRNA nucleotidyltransferase cca2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cca2 PE=1 SV=1
14	Q54BQ2	3.00e-08	58.2	558	0.152	0.118	Q54BQ2_DICDI Poly A polymerase head domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293504 PE=3 SV=1
15	Q38E99	2.37e-07	55.1	441	0.113	0.111	Q38E99_TRYB2 tRNA nucleotidyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0590 PE=3 SV=1
16	Q95M05	2.71e-06	45.8	33	0.046	0.606	Q95M05_BOVIN tRNA-nucleotidyltransferase (Fragment) OS=Bos taurus OX=9913 GN=bMtCCA PE=2 SV=1
17	Q55BE1	0.093	37.4	542	0.127	0.101	Q55BE1_DICDI Poly A polymerase head domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271378 PE=3 SV=1
18	A0A0B4LGM0	0.13	37.4	1173	0.069	0.026	A0A0B4LGM0_DROME Prominin, isoform E OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1
19	A0AVW1	0.13	37.4	1066	0.069	0.028	A0AVW1_DROME IP13255p OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1
20	B7YZQ3	0.13	37.4	1235	0.069	0.024	B7YZQ3_DROME Prominin, isoform D OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01743 PolyA_pol	1.8e-30	117.4	Poly A polymerase head domain
2	PF12627 PolyA_pol_RNAbd	2.4e-07	41.7	Probable RNA and SrmB- binding site of polymerase A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251607

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337445	0.826	Zinc phosphodiesterase ELAC protein 2
2	9606.ENSP00000368917	0.820	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
3	9606.ENSP00000264376	0.810	Gamma-crystallin D
4	9606.ENSP00000357733	0.779	Proline-rich protein 9
5	9606.ENSP00000381273	0.764	Beta-crystallin B2
6	9606.ENSP00000231198	0.760	Probable tRNA(His) guanylyltransferase
7	9606.ENSP00000327168	0.758	Proline-rich protein 7
8	9606.ENSP00000215855	0.739	Beta-crystallin B3
9	9606.ENSP00000466967	0.725	tRNA (guanine(26)-N(2))-dimethyltransferase
10	9606.ENSP00000327048	0.723	Transcription factor Maf
11	9606.ENSP00000269466	0.714	Zinc phosphodiesterase ELAC protein 1
12	9606.ENSP00000312356	0.702	tRNA methyltransferase 10 homolog C
13	9606.ENSP00000230048	0.692	Acyl-coenzyme A thioesterase 13
14	9606.ENSP00000400646	0.675	Polyribonucleotide nucleotidyltransferase 1, mitochondrial
15	9606.ENSP00000355899	0.666	RRP15-like protein
16	9606.ENSP00000425634	0.663	Histidine--tRNA ligase, cytoplasmic
17	9606.ENSP00000234677	0.651	Serine--tRNA ligase, cytoplasmic
18	9606.ENSP00000321810	0.645	tRNA dimethylallyltransferase
19	9606.ENSP00000355890	0.643	Bifunctional glutamate/proline--tRNA ligase
20	9606.ENSP00000327821	0.638	Exportin-T

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000049	1.000	tRNA binding
GO:0034062	1.000	5'-3' RNA polymerase activity
GO:0004810	1.000	CCA tRNA nucleotidyltransferase activity
GO:0005524	1.000	ATP binding
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0010467	0.986	gene expression
GO:0016070	0.986	RNA metabolic process
GO:0006399	0.970	tRNA metabolic process
GO:0008033	0.950	tRNA processing
GO:0000959	0.891	mitochondrial RNA metabolic process
GO:0031123	0.868	RNA 3'-end processing
GO:0140053	0.858	mitochondrial gene expression
GO:0000963	0.754	mitochondrial RNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0031981	0.996	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0005829	0.899	cytosol
GO:0005759	0.751	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21248	1.000	a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1)
RHEA:14433	1.000	a tRNA precursor + ATP + 2 CTP = a tRNA with a 3' CCA end + 3 diphosphate
EC:2.7.7.72	1.000	CCA tRNA nucleotidyltransferase.

[back to server]