StarFunc result for job id Q96Q15

User Input

>input (1400 residues)
MSRRAPGSRLSSGGGGGGTKYPRSWNDWQPRTDSASADPDNLKYSSSRDRGGSSSYGLQP
SNSAVVSRQRHDDTRVHADIQNDEKGGYSVNGGSGENTYGRKSLGQELRVNNVTSPEFTS
VQHGSRALATKDMRKSQERSMSYSDESRLSNLLRRITREDDRDRRLATVKQLKEFIQQPE
NKLVLVKQLDNILAAVHDVLNESSKLLQELRQEGACCLGLLCASLSYEAEKIFKWIFSKF
SSSAKDEVKLLYLCATYKALETVGEKKAFSSVMQLVMTSLQSILENVDTPELLCKCVKCI
LLVARCYPHIFSTNFRDTVDILVGWHIDHTQKPSLTQQVSGWLQSLEPFWVADLAFSTTL
LGQFLEDMEAYAEDLSHVASGESVDEDVPPPSVSLPKLAALLRVFSTVVRSIGERFSPIR
GPPITEAYVTDVLYRVMRCVTAANQVFFSEAVLTAANECVGVLLGSLDPSMTIHCDMVIT
YGLDQLENCQTCGTDYIISVLNLLTLIVEQINTKLPSSFVEKLFIPSSKLLFLRYHKEKE
VVAVAHAVYQAVLSLKNIPVLETAYKLILGEMTCALNNLLHSLQLPEACSEIKHEAFKNH
VFNVDNAKFVVIFDLSALTTIGNAKNSLIGMWALSPTVFALLSKNLMIVHSDLAVHFPAI
QYAVLYTLYSHCTRHDHFISSSLSSSSPSLFDGAVISTVTTATKKHFSIILNLLGILLKK
DNLNQDTRKLLMTWALEAAVLMKKSETYAPLFSLPSFHKFCKGLLANTLVEDVNICLQAC
SSLHALSSSLPDDLLQRCVDVCRVQLVHSGTRIRQAFGKLLKSIPLDVVLSNNNHTEIQE
ISLALRSHMSKAPSNTFHPQDFSDVISFILYGNSHRTGKDNWLERLFYSCQRLDKRDQST
IPRNLLKTDAVLWQWAIWEAAQFTVLSKLRTPLGRAQDTFQTIEGIIRSLAAHTLNPDQD
VSQWTTADNDEGHGNNQLRLVLLLQYLENLEKLMYNAYEGCANALTSPPKVIRTFFYTNR
QTCQDWLTRIRLSIMRVGLLAGQPAVTVRHGFDLLTEMKTTSLSQGNELEVTIMMVVEAL
CELHCPEAIQGIAVWSSSIVGKNLLWINSVAQQAEGRFEKASVEYQEHLCAMTGVDCCIS
SFDKSVLTLANAGRNSASPKHSLNGESRKTVLSKPTDSSPEVINYLGNKACECYISIADW
AAVQEWQNAIHDLKKSTSSTSLNLKADFNYIKSLSSFESGKFVECTEQLELLPGENINLL
AGGSKEKIDMKKLLPNMLSPDPRELQKSIEVQLLRSSVCLATALNPIEQDQKWQSITENV
VKYLKQTSRIAIGPLRLSTLTVSQSLPVLSTLQLYCSSALENTVSNRLSTEDCLIPLFSE
ALRSCKQHDVRPWMQALRYT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7pw9A	0.743	0.537	1.827E-88	1952	0.693	0.497	7pw9A.pdb.gz	Cryo-EM reconstructions of inhibitor-bound SMG1 kinase reveal an autoinhibitory state dependent on SMG8.
2	PDB:6sytA	0.726	0.539	2.242E-85	1896	0.683	0.504	6sytA.pdb.gz	InsP6binding to PIKK kinases revealed by the cryo-EM structure of an SMG1-SMG8-SMG9 complex.
3	PDB:6l53A	0.169	0.141	1.230E-29	1935	0.681	0.493	6l53A.pdb.gz
4	PDB:6l54A	0.175	0.143	3.312E-29	1911	0.665	0.487	6l54A.pdb.gz	Cryo-EM structure of SMG1-SMG8-SMG9 complex.
5	PDB:4a0cA	0.233	0.274	2.632E-8	1155	0.116	0.140	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
6	PDB:7unkA	0.195	0.242	1.389E-7	1047	0.111	0.148	7unkA.pdb.gz
7	AFDB:G5EEQ8	0.203	0.212	1.806E-7	1322	0.087	0.092	G5EEQ8.pdb.gz	G5EEQ8_CAEEL Splicing factor 3B subunit 1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sftb-1 PE=1 SV=1
8	PDB:6zwmB	0.160	0.116	5.144E-7	2185	0.124	0.079	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
9	PDB:6x9oA	0.171	0.107	8.148E-7	2425	0.110	0.064	6x9oA.pdb.gz
10	PDB:6ez8A	0.136	0.090	1.337E-6	2353	0.130	0.077	6ez8A.pdb.gz
11	AFDB:P11075	0.113	0.088	2.308E-6	2009	0.166	0.115	P11075.pdb.gz	SEC7_YEAST Protein transport protein SEC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC7 PE=1 SV=2
12	PDB:3w3uA	0.224	0.288	2.355E-6	1030	0.097	0.132	3w3uA.pdb.gz
13	AFDB:Q8RWY6	0.110	0.108	7.402E-5	1439	0.127	0.124	Q8RWY6.pdb.gz	CLASP_ARATH CLIP-associated protein OS=Arabidopsis thaliana OX=3702 GN=CLASP PE=1 SV=1
14	AFDB:Q14669	0.177	0.140	8.835E-5	1992	0.134	0.094	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
15	AFDB:Q99959	0.150	0.210	1.092E-4	881	0.057	0.091	Q99959.pdb.gz	PKP2_HUMAN Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2 PE=1 SV=2
16	AFDB:E3W994	0.115	0.126	1.259E-4	1273	0.072	0.079	E3W994.pdb.gz	E3W994_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=2
17	AFDB:Q7PLI2	0.113	0.094	4.499E-4	2077	0.136	0.092	Q7PLI2.pdb.gz	NIPB_DROME Nipped-B protein OS=Drosophila melanogaster OX=7227 GN=Nipped-B PE=1 SV=3
18	AFDB:Q55BH2	0.064	0.061	6.409E-4	1505	0.126	0.118	Q55BH2.pdb.gz	Q55BH2_DICDI C2 calcium/lipid-binding region-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271334 PE=4 SV=1
19	AFDB:B0BF33	0.107	0.150	1.446E-3	815	0.072	0.124	B0BF33.pdb.gz	PKP2_DANRE Plakophilin-2 OS=Danio rerio OX=7955 GN=pkp2 PE=2 SV=1
20	AFDB:D3ZK73	0.081	0.105	1.853E-3	971	0.065	0.094	D3ZK73.pdb.gz	D3ZK73_RAT Cullin 4B OS=Rattus norvegicus OX=10116 GN=Cul4b PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KRA9	0.0	2644	3551	0.921	0.363	J3KRA9_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=SMG1 PE=1 SV=1
2	Q8BKX6	0.0	2838	3658	0.979	0.375	SMG1_MOUSE Serine/threonine-protein kinase SMG1 OS=Mus musculus OX=10090 GN=Smg1 PE=1 SV=3
3	Q96Q15	0.0	2906	3661	1.000	0.382	SMG1_HUMAN Serine/threonine-protein kinase SMG1 OS=Homo sapiens OX=9606 GN=SMG1 PE=1 SV=3
4	Q70PP2	3.08e-56	218	3218	0.179	0.078	SMG1_DROME Serine/threonine-protein kinase Smg1 OS=Drosophila melanogaster OX=7227 GN=nonC PE=1 SV=2
5	O01510	7.00e-24	112	2322	0.084	0.050	SMG1_CAEEL Serine/threonine-protein kinase smg-1 OS=Caenorhabditis elegans OX=6239 GN=smg-1 PE=1 SV=3
6	Q27968	2.8	34.7	504	0.010	0.028	DNJC3_BOVIN DnaJ homolog subfamily C member 3 OS=Bos taurus OX=9913 GN=DNAJC3 PE=1 SV=1
7	P70039	3.8	34.7	2829	0.029	0.014	APC_XENLA Adenomatous polyposis coli homolog OS=Xenopus laevis OX=8355 GN=apc PE=1 SV=2
8	Q13217	4.2	34.3	504	0.010	0.028	DNJC3_HUMAN DnaJ homolog subfamily C member 3 OS=Homo sapiens OX=9606 GN=DNAJC3 PE=1 SV=1
9	Q91YW3	4.5	33.9	504	0.010	0.028	DNJC3_MOUSE DnaJ homolog subfamily C member 3 OS=Mus musculus OX=10090 GN=Dnajc3 PE=1 SV=1
10	O95714	5.2	34.3	4834	0.014	0.004	HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2
11	O41928	6.4	33.9	1103	0.022	0.028	O41928_MHV68 Major DNA-binding protein OS=Murid herpesvirus 4 OX=33708 GN=GAMMAHV.ORF6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15785 SMG1	1.5e-251	847.8	Serine/threonine-protein kinase smg-1
2	PF17229 SMG1_N	1e-44	162.9	Serine/threonine-protein kinase SMG1 N-terminal
3	PF08389 Xpo1	64	15.0	Exportin 1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000402515

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270066	0.999	Protein SMG9
2	9606.ENSP00000276201	0.999	Regulator of nonsense transcripts 3B
3	9606.ENSP00000348708	0.999	Regulator of nonsense transcripts 2
4	9606.ENSP00000364448	0.999	Regulator of nonsense transcripts 3A
5	9606.ENSP00000425133	0.999	Protein SMG7
6	9606.ENSP00000438748	0.999	Protein SMG8
7	9606.ENSP00000470142	0.999	Regulator of nonsense transcripts 1
8	9606.ENSP00000269349	0.998	Eukaryotic initiation factor 4A-III
9	9606.ENSP00000360525	0.997	Protein mago nashi homolog
10	9606.ENSP00000463058	0.995	RNA-binding protein 8A
11	9606.ENSP00000353741	0.990	Eukaryotic peptide chain release factor subunit 1
12	9606.ENSP00000398131	0.987	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
13	9606.ENSP00000326806	0.970	Nuclear cap-binding protein subunit 2
14	9606.ENSP00000355261	0.970	Protein SMG5
15	9606.ENSP00000313007	0.958	Polyadenylate-binding protein 1
16	9606.ENSP00000341247	0.949	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B
17	9606.ENSP00000263073	0.946	Telomerase-binding protein EST1A
18	9606.ENSP00000362547	0.915	TELO2-interacting protein 1 homolog
19	9606.ENSP00000262319	0.898	Telomere length regulation protein TEL2 homolog
20	9606.ENSP00000473172	0.856	RuvB-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0042162	1.000	telomeric DNA binding
GO:0004697	1.000	protein kinase C activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050658	0.949	RNA transport
GO:0019219	0.947	regulation of nucleobase-containing compound metabolic process
GO:0048583	0.939	regulation of response to stimulus
GO:0090304	0.906	nucleic acid metabolic process
GO:0051028	0.898	mRNA transport
GO:0051168	0.893	nuclear export
GO:0016310	0.892	phosphorylation
GO:0010467	0.876	gene expression
GO:0019538	0.876	protein metabolic process
GO:0018193	0.869	peptidyl-amino acid modification
GO:0006405	0.869	RNA export from nucleus
GO:0051128	0.849	regulation of cellular component organization
GO:0060255	0.836	regulation of macromolecule metabolic process
GO:0019637	0.811	organophosphate metabolic process
GO:0000956	0.808	nuclear-transcribed mRNA catabolic process
GO:0006468	0.799	protein phosphorylation
GO:0009058	0.795	biosynthetic process
GO:1901576	0.794	organic substance biosynthetic process
GO:0044249	0.794	cellular biosynthetic process
GO:0000184	0.773	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0018209	0.730	peptidyl-serine modification
GO:0044255	0.678	cellular lipid metabolic process
GO:0006406	0.634	mRNA export from nucleus
GO:0006644	0.500	phospholipid metabolic process
GO:0046486	0.490	glycerolipid metabolic process
GO:0046488	0.475	phosphatidylinositol metabolic process
GO:0051052	0.467	regulation of DNA metabolic process
GO:0033043	0.460	regulation of organelle organization
GO:0008610	0.441	lipid biosynthetic process
GO:0090407	0.358	organophosphate biosynthetic process
GO:0046474	0.345	glycerophospholipid biosynthetic process
GO:0006661	0.343	phosphatidylinositol biosynthetic process
GO:0033044	0.305	regulation of chromosome organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.995	nucleoplasm
GO:0005829	0.982	cytosol
GO:0043232	0.965	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.13	1.000	protein kinase C.

[back to server]