StarFunc result for job id Q96Q40

User Input

>input (435 residues)
MGQELCAKTVQPGCSCYHCSEGGEAHSCRRSQPETTEAAFKLTDLKEASCSMTSFHPRGL
QAARAQKFKSKRPRSNSDCFQEEDLRQGFQWRKSLPFGAASSYLNLEKLGEGSYATVYKG
ISRINGQLVALKVISMNAEEGVPFTAIREASLLKGLKHANIVLLHDIIHTKETLTFVFEY
MHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQHVLHRDLKPQNLLISHLGELKL
ADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLF
PGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPTPRSLHVVWNRLGRVPEA
EDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKPEMCDLLA
SYQKGHHPAQFSKCW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96Q40	1.000	1.000	6.932E-83	435	1.000	1.000	Q96Q40.pdb.gz	CDK15_HUMAN Cyclin-dependent kinase 15 OS=Homo sapiens OX=9606 GN=CDK15 PE=1 SV=2
2	AFDB:Q7KM03	0.742	0.620	1.075E-50	522	0.492	0.410	Q7KM03.pdb.gz	Q7KM03_DROME Ecdysone-induced protein 63E, isoform G OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=1 SV=1
3	AFDB:O35495	0.702	0.652	6.010E-49	469	0.547	0.507	O35495.pdb.gz	CDK14_MOUSE Cyclin-dependent kinase 14 OS=Mus musculus OX=10090 GN=Cdk14 PE=1 SV=2
4	AFDB:A0A024R183	0.708	0.616	1.651E-43	502	0.451	0.390	A0A024R183.pdb.gz
5	AFDB:Q00537	0.725	0.605	3.449E-43	523	0.437	0.363	Q00537.pdb.gz	CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens OX=9606 GN=CDK17 PE=1 SV=2
6	AFDB:Q07002	0.720	0.661	1.071E-42	474	0.437	0.401	Q07002.pdb.gz	CDK18_HUMAN Cyclin-dependent kinase 18 OS=Homo sapiens OX=9606 GN=CDK18 PE=1 SV=4
7	AFDB:G5EAZ1	0.656	0.778	4.632E-37	366	0.386	0.459	G5EAZ1.pdb.gz	G5EAZ1_EMENI Protein kinase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08261 PE=3 SV=1
8	AFDB:O74456	0.642	0.966	3.181E-36	288	0.347	0.524	O74456.pdb.gz	PEF1_SCHPO Serine/threonine-protein kinase pef1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pef1 PE=3 SV=2
9	AFDB:Q8I7M8	0.694	0.460	1.239E-35	667	0.411	0.268	Q8I7M8.pdb.gz	CDK17_CAEEL Cyclin-dependent kinase 17 OS=Caenorhabditis elegans OX=6239 GN=pct-1 PE=1 SV=1
10	AFDB:P17157	0.652	0.926	1.555E-35	305	0.352	0.502	P17157.pdb.gz	PHO85_YEAST Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO85 PE=1 SV=2
11	PDB:4krcA	0.626	0.905	3.632E-33	297	0.352	0.515	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
12	PDB:1unlA	0.617	0.907	2.274E-31	292	0.345	0.514	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
13	PDB:4yc3A	0.637	0.929	7.632E-30	295	0.306	0.451	4yc3A.pdb.gz
14	PDB:4gcjA	0.598	0.842	1.687E-29	304	0.326	0.467	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
15	PDB:4ek6A	0.581	0.890	6.574E-29	279	0.303	0.473	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
16	PDB:4eomC	0.566	0.881	1.118E-27	276	0.301	0.475	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
17	PDB:3mi9A	0.615	0.803	4.115E-27	329	0.287	0.380	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.
18	PDB:1blxA	0.568	0.791	1.305E-25	305	0.274	0.390	1blxA.pdb.gz	Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
19	PDB:7cgaA	0.582	0.722	4.540E-25	347	0.234	0.294	7cgaA.pdb.gz
20	PDB:1j1bB	0.601	0.712	3.118E-24	364	0.248	0.297	1j1bB.pdb.gz	Structural insight into nucleotide recognition in tau-protein kinase I/glycogen synthase kinase 3 beta.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96Q40	0.0	906	435	1.000	1.000	CDK15_HUMAN Cyclin-dependent kinase 15 OS=Homo sapiens OX=9606 GN=CDK15 PE=1 SV=2
2	O35495	1.65e-165	475	469	0.515	0.478	CDK14_MOUSE Cyclin-dependent kinase 14 OS=Mus musculus OX=10090 GN=Cdk14 PE=1 SV=2
3	O94921	1.94e-165	475	469	0.515	0.478	CDK14_HUMAN Cyclin-dependent kinase 14 OS=Homo sapiens OX=9606 GN=CDK14 PE=1 SV=3
4	Q8MZ44	1.84e-146	423	367	0.483	0.572	Q8MZ44_DROME LD27880p OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=2 SV=1
5	Q7KM04	1.83e-145	426	501	0.467	0.405	Q7KM04_DROME Ecdysone-induced protein 63E, isoform H OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=2 SV=1
6	Q9XTK9	3.28e-145	426	522	0.467	0.389	Q9XTK9_DROME Ecdysone-induced protein 63E, isoform D OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=2 SV=2
7	Q7KM03	3.35e-145	426	522	0.467	0.389	Q7KM03_DROME Ecdysone-induced protein 63E, isoform G OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=1 SV=1
8	Q7KM08	3.79e-145	425	509	0.467	0.399	Q7KM08_DROME Ecdysone-induced protein 63E, isoform F OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=2 SV=1
9	Q7KM05	3.84e-145	425	509	0.467	0.399	Q7KM05_DROME Ecdysone-induced protein 63E, isoform A OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=2 SV=1
10	M9PE01	4.13e-145	426	538	0.467	0.377	M9PE01_DROME Ecdysone-induced protein 63E, isoform N OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=4 SV=1
11	Q94888	2.23e-144	423	509	0.467	0.399	Q94888_DROME Serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=2 SV=1
12	Q9BRL4	2.30e-121	362	448	0.414	0.402	Q9BRL4_HUMAN PCTK1 protein OS=Homo sapiens OX=9606 GN=PCTK1 PE=1 SV=1
13	A0A140VK97	1.92e-120	361	496	0.414	0.363	A0A140VK97_HUMAN Testis secretory sperm-binding protein Li 224n OS=Homo sapiens OX=9606 PE=2 SV=1
14	Q00536	1.92e-120	361	496	0.414	0.363	CDK16_HUMAN Cyclin-dependent kinase 16 OS=Homo sapiens OX=9606 GN=CDK16 PE=1 SV=1
15	Q04735	1.25e-119	359	496	0.409	0.359	CDK16_MOUSE Cyclin-dependent kinase 16 OS=Mus musculus OX=10090 GN=Cdk16 PE=1 SV=1
16	Q63686	4.80e-119	358	496	0.409	0.359	CDK16_RAT Cyclin-dependent kinase 16 OS=Rattus norvegicus OX=10116 GN=Cdk16 PE=1 SV=1
17	Q00537	2.26e-116	352	523	0.414	0.344	CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens OX=9606 GN=CDK17 PE=1 SV=2
18	Q07002	7.82e-114	344	474	0.402	0.369	CDK18_HUMAN Cyclin-dependent kinase 18 OS=Homo sapiens OX=9606 GN=CDK18 PE=1 SV=4
19	A0A1D8PDA6	2.96e-101	306	332	0.359	0.470	A0A1D8PDA6_CANAL Cyclin-dependent serine/threonine-protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHO85 PE=3 SV=1
20	Q8I7M8	3.74e-101	317	667	0.370	0.241	CDK17_CAEEL Cyclin-dependent kinase 17 OS=Caenorhabditis elegans OX=6239 GN=pct-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.56	20.8	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	1.7	19.1	Haspin like kinase domain
3	PF14531 Kinase-like	5.2	17.9	Kinase-like
4	PF00069 Pkinase	3.6e-64	228.3	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	2.1e-29	114.2	Protein tyrosine and serine/threonine kinase
6	PF07387 Seadorna_VP7	1.3e+02	13.0	Seadornavirus VP7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000027840

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000015116	0.862	Cell division control protein
2	9593.ENSGGOP00000007479	0.841	Cyclin B2
3	9593.ENSGGOP00000021956	0.841	Uncharacterized protein
4	9593.ENSGGOP00000027066	0.841	Cyclin B1
5	9593.ENSGGOP00000001670	0.840	Proliferating cell nuclear antigen
6	9593.ENSGGOP00000017490	0.840	Proliferating cell nuclear antigen
7	9593.ENSGGOP00000013726	0.831	Origin recognition complex, subunit 2
8	9593.ENSGGOP00000018002	0.830	Cyclin B3
9	9593.ENSGGOP00000004909	0.801	DNA helicase
10	9593.ENSGGOP00000005036	0.801	Protein kinase, membrane associated tyrosine/threonine 1
11	9593.ENSGGOP00000024568	0.788	Kinesin family member 11
12	9593.ENSGGOP00000005067	0.781	Cyclin H
13	9593.ENSGGOP00000027926	0.780	Chromatin licensing and DNA replication factor 1
14	9593.ENSGGOP00000009443	0.774	DNA helicase
15	9593.ENSGGOP00000003862	0.768	Origin recognition complex, subunit 1
16	9593.ENSGGOP00000002165	0.763	Fizzy/cell division cycle 20 related 1 (Drosophila)
17	9593.ENSGGOP00000008259	0.763	Cyclin E1
18	9593.ENSGGOP00000010165	0.763	Cell division cycle 20
19	9593.ENSGGOP00000014576	0.763	Cyclin E2
20	9593.ENSGGOP00000017791	0.763	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0004693	0.355	cyclin-dependent protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.991	organic substance metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0044238	0.989	primary metabolic process
GO:0050789	0.985	regulation of biological process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0050794	0.977	regulation of cellular process
GO:0043170	0.974	macromolecule metabolic process
GO:1901564	0.938	organonitrogen compound metabolic process
GO:0019538	0.927	protein metabolic process
GO:0043412	0.911	macromolecule modification
GO:0006468	0.899	protein phosphorylation
GO:0019222	0.724	regulation of metabolic process
GO:0080090	0.644	regulation of primary metabolic process
GO:0060255	0.583	regulation of macromolecule metabolic process
GO:0007049	0.573	cell cycle
GO:0022402	0.539	cell cycle process
GO:0031323	0.538	regulation of cellular metabolic process
GO:0048518	0.526	positive regulation of biological process
GO:0051171	0.522	regulation of nitrogen compound metabolic process
GO:0000278	0.516	mitotic cell cycle
GO:0048522	0.515	positive regulation of cellular process
GO:0051726	0.498	regulation of cell cycle
GO:0050896	0.456	response to stimulus
GO:1903047	0.444	mitotic cell cycle process
GO:0071840	0.438	cellular component organization or biogenesis
GO:0016043	0.434	cellular component organization
GO:0032501	0.342	multicellular organismal process
GO:0044770	0.337	cell cycle phase transition
GO:0051716	0.331	cellular response to stimulus
GO:0044772	0.331	mitotic cell cycle phase transition
GO:0051246	0.308	regulation of protein metabolic process
GO:0006996	0.306	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005737	0.991	cytoplasm
GO:0031981	0.979	nuclear lumen
GO:0005654	0.972	nucleoplasm
GO:0032991	0.965	protein-containing complex
GO:0016020	0.936	membrane
GO:0005829	0.914	cytosol
GO:0043232	0.868	intracellular non-membrane-bounded organelle
GO:1990234	0.817	transferase complex
GO:0000307	0.691	cyclin-dependent protein kinase holoenzyme complex
GO:0005886	0.515	plasma membrane
GO:0015630	0.324	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.22	0.355	cyclin-dependent kinase.

[back to server]