StarFunc result for job id Q96Q42

User Input

>input (1657 residues)
MDSKKRSSTEAEGSKERGLVHIWQAGSFPITPERLPGWGGKTVLQAALGVKHGVLLTEDG
EVYSFGTLPWRSGPVEICPSSPILENALVGQYVITVATGSFHSGAVTDNGVAYMWGENSA
GQCAVANQQYVPEPNPVSIADSEASPLLAVRILQLACGEEHTLALSISREIWAWGTGCQL
GLITTAFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLPSQDLKPVPERCNQCSQLLI
TMTDKEDHVIISDSHCCPLGVTLTESQAENHASTALSPSTETLDRQEEVFENTLVANDQS
VATELNAVSAQITSSDAMSSQQNVMGTTEISSARNIPSYPDTQAVNEYLRKLSDHSVRED
SEHGEKPVPSQPLLEEAIPNLHSPPTTSTSALNSLVVSCASAVGVRVAATYEAGALSLKK
VMNFYSTTPCETGAQAGSSAIGPEGLKDSREEQVKQESMQGKKSSSLVDIREEETEGGSR
RLSLPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQLG
HGDVLPRLQPLCVKCLDGKEVIHLEAGGYHSLALTAKSQVYSWGSNTFGQLGHSDFPTTV
PRLAKISSENGVWSIAAGRDYSLFLVDTEDFQPGLYYSGRQDPTEGDNLPENHSGSKTPV
LLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSDIKSQILRPL
LSLENLGTTTTVQLLQEVASRFSKLCYLIGQHGASLSSFLHGVKEARSLVILKHSSLFLD
SYTEYCTSITNFLVMGGFQLLAKPAIDFLNKNQELLQDLSEVNDENTQLMEILNTLFFLP
IRRLHNYAKVLLKLATCFEVASPEYQKLQDSSSCYECLALHLGRKRKEAEYTLGFWKTFP
GKMTDSLRKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATLW
AEPLSEEAGGVNGLKITTPEEQFTLISSTPQEKTKWLRAISQAVDQALRGMSDLPPYGSG
SSVQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSGKPHGRGVLKWPDGKMYSGMFRNGL
EDGYGEYRIPNKAMNKEDHYVGHWKEGKMCGQGVYSYASGEVFEGCFQDNMRHGHGLLRS
GKLTSSSPSMFIGQWVMDKKAGYGVFDDITRGEKYMGMWQDDVCQGNGVVVTQFGLYYEG
NFHLNKMMGNGVLLSEDDTIYEGEFSDDWTLSGKGTLTMPNGDYIEGYFSGEWGSGIKIT
GTYFKPSLYESDKDRPKVFRKLGNLAVPADEKWKAVFDECWRQLGCEGPGQGEVWKAWDN
IAVALTTSRRQHRDSPEILSRSQTQTLESLEFIPQHVGAFSVEKYDDIRKYLIKACDTPL
HPLGRLVETLVAVYRMTYVGVGANRRLLQEAVKEIKSYLKRIFQLVRFLFPELPEEGSTI
PLSAPLPTERKSFCTGKSDSRSESPEPGYVVTSSGLLLPVLLPRLYPPLFMLYALDNDRE
EDIYWECVLRLNKQPDIALLGFLGVQRKFWPATLSILGESKKVLPTTKDACFASAVECLQ
QISTTFTPSDKLKVIQQTFEEISQSVLASLHEDFLWSMDDLFPVFLYVVLRARIRNLGSE
VHLIEDLMDPYLQHGEQGIMFTTLKACYYQIQREKLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96Q42	1.000	1.000	0.000	1657	1.000	1.000	Q96Q42.pdb.gz	ALS2_HUMAN Alsin OS=Homo sapiens OX=9606 GN=ALS2 PE=1 SV=2
2	PDB:8gqeB	0.175	0.702	1.018E-12	386	0.054	0.233	8gqeB.pdb.gz
3	AFDB:Q8TD19	0.196	0.326	2.338E-11	979	0.053	0.090	Q8TD19.pdb.gz	NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2
4	PDB:5tbkI	0.188	0.692	2.063E-10	419	0.057	0.224	5tbkI.pdb.gz
5	PDB:5t94A	0.189	0.642	8.961E-10	454	0.059	0.214	5t94A.pdb.gz
6	PDB:5xgsA	0.184	0.709	8.270E-9	398	0.054	0.224	5xgsA.pdb.gz
7	AFDB:Q9Y7U6	0.126	0.150	1.769E-8	1334	0.081	0.100	Q9Y7U6.pdb.gz	RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf1 PE=1 SV=1
8	AFDB:P98174	0.101	0.148	3.902E-8	961	0.087	0.150	P98174.pdb.gz	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
9	AFDB:Q6ZNL6	0.109	0.122	7.982E-8	1462	0.078	0.089	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
10	PDB:7dmpA	0.098	0.781	1.884E-7	186	0.028	0.247	7dmpA.pdb.gz
11	AFDB:Q54DW4	0.117	0.136	4.347E-7	1350	0.098	0.121	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
12	AFDB:E7EY47	0.133	0.208	2.280E-6	958	0.081	0.141	E7EY47.pdb.gz	E7EY47_DANRE Rho guanine nucleotide exchange factor (GEF) 19 OS=Danio rerio OX=7955 GN=arhgef19 PE=4 SV=1
13	AFDB:Q12774	0.144	0.149	7.903E-6	1597	0.081	0.085	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
14	PDB:7rx9A	0.097	0.323	9.121E-6	432	0.042	0.160	7rx9A.pdb.gz
15	AFDB:E9Q7D5	0.145	0.150	1.679E-5	1581	0.075	0.079	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
16	PDB:4d4oA	0.102	0.380	3.283E-5	414	0.023	0.092	4d4oA.pdb.gz	Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
17	AFDB:E9PDR5	0.176	0.248	5.004E-5	1152	0.059	0.085	E9PDR5.pdb.gz	E9PDR5_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens OX=9606 GN=IBTK PE=1 SV=1
18	PDB:4mt6A	0.120	0.351	1.181E-4	389	0.027	0.116	4mt6A.pdb.gz
19	PDB:6jleA	0.057	0.613	2.158E-4	144	0.021	0.236	6jleA.pdb.gz
20	PDB:4gouA	0.110	0.278	3.029E-4	507	0.030	0.097	4gouA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z5Q7	0.0	1603	812	0.478	0.975	A0A0S2Z5Q7_HUMAN Alsin Rho guanine nucleotide exchange factor ALS2 (Fragment) OS=Homo sapiens OX=9606 GN=ALS2 PE=1 SV=1
2	P0C5Y8	0.0	3122	1651	0.914	0.917	ALS2_RAT Alsin OS=Rattus norvegicus OX=10116 GN=Als2 PE=1 SV=1
3	Q920R0	0.0	3140	1651	0.920	0.923	ALS2_MOUSE Alsin OS=Mus musculus OX=10090 GN=Als2 PE=1 SV=3
4	Q96Q42	0.0	3432	1657	1.000	1.000	ALS2_HUMAN Alsin OS=Homo sapiens OX=9606 GN=ALS2 PE=1 SV=2
5	Q60I27	4.06e-153	495	953	0.199	0.346	AL2CL_HUMAN ALS2 C-terminal-like protein OS=Homo sapiens OX=9606 GN=ALS2CL PE=1 SV=1
6	Q60I26	2.34e-149	485	952	0.196	0.340	AL2CL_MOUSE ALS2 C-terminal-like protein OS=Mus musculus OX=10090 GN=Als2cl PE=1 SV=1
7	Q9VNZ8	9.32e-46	184	1486	0.101	0.113	ALS2_DROME Alsin homolog OS=Drosophila melanogaster OX=7227 GN=Als2 PE=1 SV=1
8	Q587D3	1.22e-28	121	358	0.054	0.251	Q587D3_TRYB2 MORN repeat-containing protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.330 PE=1 SV=1
9	F2Z461	3.54e-18	93.6	1003	0.044	0.073	HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
10	E9PYQ0	1.20e-17	92.0	876	0.039	0.073	RS10B_MOUSE Radial spoke head 10 homolog B OS=Mus musculus OX=10090 GN=Rsph10b PE=1 SV=1
11	Q9M1K2	1.74e-17	91.3	779	0.040	0.085	PI5K4_ARATH Phosphatidylinositol 4-phosphate 5-kinase 4 OS=Arabidopsis thaliana OX=3702 GN=PIP5K4 PE=4 SV=1
12	Q9SFB8	2.31e-17	90.5	715	0.033	0.077	PI5K6_ARATH Phosphatidylinositol 4-phosphate 5-kinase 6 OS=Arabidopsis thaliana OX=3702 GN=PIP5K6 PE=2 SV=1
13	Q9LFS0	3.18e-17	88.2	396	0.037	0.154	Q9LFS0_ARATH At5g16040 OS=Arabidopsis thaliana OX=3702 GN=At5g16040 PE=1 SV=1
14	Q6PAV2	4.29e-17	90.1	1057	0.038	0.060	HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus OX=10090 GN=Herc4 PE=1 SV=2
15	Q5GLZ8	6.72e-17	89.7	1057	0.038	0.060	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
16	Q9SLG9	1.18e-16	88.6	772	0.037	0.079	PI5K5_ARATH Phosphatidylinositol 4-phosphate 5-kinase 5 OS=Arabidopsis thaliana OX=3702 GN=PIP5K5 PE=2 SV=1
17	B8A4R1	1.48e-16	87.4	531	0.039	0.121	B8A4R1_DANRE RCC1 and BTB domain-containing protein 1 isoform X1 OS=Danio rerio OX=7955 GN=fj43a07 PE=1 SV=1
18	Q0WSJ9	1.48e-16	86.3	393	0.037	0.155	Q0WSJ9_ARATH Regulator of chromosome condensation (RCC1) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g02510 PE=1 SV=1
19	Q7ZVG0	1.56e-16	87.4	531	0.039	0.121	Q7ZVG0_DANRE RCC1 and BTB domain-containing protein 1 OS=Danio rerio OX=7955 GN=wu:fj43a07 PE=1 SV=1
20	D6RCL5	4.26e-16	82.0	240	0.038	0.263	D6RCL5_HUMAN HECT and RLD domain containing E3 ubiquitin protein ligase 4 (Fragment) OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07946 CCDC47	6.3e+02	10.9	PAT complex subunit CCDC47
2	PF02493 MORN	2.5e-27	104.2	MORN repeat
3	PF00169 PH	4.2e+02	12.9	PH domain
4	PF00415 RCC1	2.6e-36	135.3	Regulator of chromosome condensation (RCC1) repeat
5	PF13540 RCC1_2	3.8e-25	98.4	Regulator of chromosome condensation (RCC1) repeat
6	PF00621 RhoGEF	0.00016	33.4	RhoGEF domain
7	PF02204 VPS9	5.5e-21	86.1	Vacuolar sorting protein 9 (VPS9) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264276

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000273047	0.990	Ras-related protein Rab-5A
2	9606.ENSP00000447053	0.932	Ras-related protein Rab-5C
3	9606.ENSP00000353444	0.929	Ras-related protein Rab-5B
4	9606.ENSP00000369538	0.914	Rab GDP dissociation inhibitor beta
5	9606.ENSP00000350386	0.909	Rab proteins geranylgeranyltransferase component A 1
6	9606.ENSP00000355511	0.908	Rab proteins geranylgeranyltransferase component A 2
7	9606.ENSP00000394071	0.908	Rab GDP dissociation inhibitor alpha
8	9606.ENSP00000224140	0.841	Probable helicase senataxin
9	9606.ENSP00000377664	0.815	GTPase-activating protein and VPS9 domain-containing protein 1
10	9606.ENSP00000381047	0.815	Protein C21orf2
11	9606.ENSP00000424757	0.812	Serine/threonine-protein kinase Nek1
12	9606.ENSP00000417175	0.799	Vesicle-associated membrane protein-associated protein B/C
13	9606.ENSP00000370208	0.796	RAB guanine nucleotide exchange factor 1
14	9606.ENSP00000354791	0.795	Dynactin subunit 1
15	9606.ENSP00000261866	0.780	Spatacsin
16	9606.ENSP00000270142	0.774	Superoxide dismutase [Cu-Zn]
17	9606.ENSP00000263780	0.759	Charged multivesicular body protein 2b
18	9606.ENSP00000230124	0.753	Polyphosphoinositide phosphatase
19	9606.ENSP00000482753	0.748	Guanine nucleotide exchange C9orf72
20	9606.ENSP00000254108	0.736	RNA-binding protein FUS

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0031267	0.994	small GTPase binding
GO:0030295	0.987	protein kinase activator activity
GO:0005085	0.985	guanyl-nucleotide exchange factor activity
GO:0042802	0.970	identical protein binding
GO:0043539	0.914	protein serine/threonine kinase activator activity
GO:0042803	0.903	protein homodimerization activity
GO:0005096	0.896	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.994	biological regulation
GO:0009987	0.994	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0016043	0.967	cellular component organization
GO:0050896	0.953	response to stimulus
GO:0032501	0.928	multicellular organismal process
GO:0051179	0.899	localization
GO:0006810	0.887	transport
GO:0051641	0.883	cellular localization
GO:0043087	0.867	regulation of GTPase activity
GO:0046907	0.850	intracellular transport
GO:0044093	0.764	positive regulation of molecular function
GO:0051056	0.754	regulation of small GTPase mediated signal transduction
GO:0031323	0.746	regulation of cellular metabolic process
GO:0032502	0.745	developmental process
GO:0048856	0.729	anatomical structure development
GO:0048518	0.689	positive regulation of biological process
GO:0007154	0.669	cell communication
GO:0051345	0.661	positive regulation of hydrolase activity
GO:0008152	0.660	metabolic process
GO:0023052	0.659	signaling
GO:0048522	0.653	positive regulation of cellular process
GO:0044085	0.641	cellular component biogenesis
GO:0022607	0.628	cellular component assembly
GO:0043547	0.599	positive regulation of GTPase activity
GO:0071704	0.596	organic substance metabolic process
GO:0044237	0.596	cellular metabolic process
GO:0060255	0.526	regulation of macromolecule metabolic process
GO:0080090	0.492	regulation of primary metabolic process
GO:0051171	0.479	regulation of nitrogen compound metabolic process
GO:0006996	0.474	organelle organization
GO:0007275	0.454	multicellular organism development
GO:0030030	0.398	cell projection organization
GO:0051246	0.357	regulation of protein metabolic process
GO:0016192	0.350	vesicle-mediated transport
GO:0048731	0.342	system development
GO:0007399	0.334	nervous system development
GO:0009893	0.321	positive regulation of metabolic process
GO:0051716	0.311	cellular response to stimulus
GO:0048869	0.300	cellular developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0030425	0.999	dendrite
GO:0005829	0.996	cytosol
GO:0032991	0.994	protein-containing complex
GO:0012505	0.994	endomembrane system
GO:0005634	0.994	nucleus
GO:0016020	0.991	membrane
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0031982	0.914	vesicle
GO:0005856	0.891	cytoskeleton
GO:0031410	0.873	cytoplasmic vesicle
GO:0005815	0.708	microtubule organizing center
GO:0005813	0.683	centrosome
GO:0005768	0.628	endosome
GO:0005769	0.535	early endosome
GO:0031090	0.514	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]