StarFunc result for job id Q96Q80

User Input

>input (235 residues)
MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTN
FLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFL
GQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGH
IYYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLPPPQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96Q80	1.000	1.000	7.167E-34	235	1.000	1.000	Q96Q80.pdb.gz	DERL3_HUMAN Derlin-3 OS=Homo sapiens OX=9606 GN=DERL3 PE=1 SV=2
2	AFDB:Q8BNI4	0.952	0.936	5.978E-28	239	0.745	0.732	Q8BNI4.pdb.gz	DERL2_MOUSE Derlin-2 OS=Mus musculus OX=10090 GN=Derl2 PE=1 SV=2
3	AFDB:Q9VEU2	0.884	0.797	7.013E-23	261	0.574	0.517	Q9VEU2.pdb.gz	Q9VEU2_DROME Derlin OS=Drosophila melanogaster OX=7227 GN=Der-2 PE=1 SV=1
4	AFDB:Q4WDG5	0.825	0.780	2.721E-17	249	0.383	0.361	Q4WDG5.pdb.gz	Q4WDG5_ASPFU Derlin OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G04670 PE=3 SV=1
5	AFDB:A2R4J5	0.829	0.793	3.141E-17	246	0.387	0.370	A2R4J5.pdb.gz	A2R4J5_ASPNC Derlin OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An15g00640 PE=3 SV=1
6	AFDB:Q8VZU9	0.829	0.735	6.437E-17	266	0.345	0.305	Q8VZU9.pdb.gz	DERL1_ARATH Derlin-1 OS=Arabidopsis thaliana OX=3702 GN=DER1 PE=2 SV=1
7	AFDB:A0A024R9G3	0.851	0.798	9.838E-16	251	0.311	0.291	A0A024R9G3.pdb.gz
8	AFDB:Q9VQ57	0.852	0.819	4.106E-14	245	0.289	0.278	Q9VQ57.pdb.gz	DERL1_DROME Derlin-1 OS=Drosophila melanogaster OX=7227 GN=Der-1 PE=2 SV=1
9	AFDB:Q382S2	0.794	0.740	4.710E-13	253	0.277	0.257	Q382S2.pdb.gz	Q382S2_TRYB2 Derlin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4430 PE=3 SV=1
10	AFDB:Q93561	0.835	0.802	4.710E-13	245	0.294	0.282	Q93561.pdb.gz	DERL1_CAEEL Derlin-1 OS=Caenorhabditis elegans OX=6239 GN=cup-2 PE=2 SV=1
11	PDB:7czbA	0.674	0.806	3.551E-7	194	0.289	0.351	7czbA.pdb.gz
12	PDB:6vk0C	0.579	0.729	1.962E-4	180	0.183	0.239	6vk0C.pdb.gz
13	PDB:2nr9A	0.504	0.599	2.033E-2	192	0.162	0.198	2nr9A.pdb.gz	The crystal structure of the rhomboid peptidase from Haemophilus influenzae provides insight into intramembrane proteolysis.
14	PDB:3odjA	0.468	0.668	2.033E-2	157	0.132	0.197	3odjA.pdb.gz
15	PDB:6sswB	0.134	0.171	2.943	140	0.123	0.207	6sswB.pdb.gz	Crystal structures of human MGST2 reveal synchronized conformational changes regulating catalysis.
16	PDB:7b93N	0.148	0.106	3.239	345	0.043	0.029	7b93N.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
17	PDB:7jvqR	0.140	0.124	3.564	286	0.106	0.087	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
18	PDB:7e32R	0.150	0.134	4.527	285	0.085	0.070	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
19	PDB:7xtbR	0.183	0.164	4.527	278	0.162	0.137	7xtbR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
20	PDB:1jqiA	0.161	0.107	4.981	384	0.098	0.060	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96Q80	2.46e-168	465	235	1.000	1.000	DERL3_HUMAN Derlin-3 OS=Homo sapiens OX=9606 GN=DERL3 PE=1 SV=2
2	Q9GZP9	1.45e-129	367	239	0.753	0.741	DERL2_HUMAN Derlin-2 OS=Homo sapiens OX=9606 GN=DERL2 PE=1 SV=1
3	Q8BNI4	5.28e-129	365	239	0.745	0.732	DERL2_MOUSE Derlin-2 OS=Mus musculus OX=10090 GN=Derl2 PE=1 SV=2
4	Q9VEU2	3.39e-96	283	261	0.570	0.513	Q9VEU2_DROME Derlin OS=Drosophila melanogaster OX=7227 GN=Der-2 PE=1 SV=1
5	Q4WDG5	3.72e-52	171	249	0.391	0.369	Q4WDG5_ASPFU Derlin OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G04670 PE=3 SV=1
6	A2R4J5	5.69e-51	167	246	0.383	0.366	A2R4J5_ASPNC Derlin OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An15g00640 PE=3 SV=1
7	Q8VZU9	8.37e-46	155	266	0.336	0.297	DERL1_ARATH Derlin-1 OS=Arabidopsis thaliana OX=3702 GN=DER1 PE=2 SV=1
8	Q9BUN8	5.54e-36	129	251	0.311	0.291	DERL1_HUMAN Derlin-1 OS=Homo sapiens OX=9606 GN=DERL1 PE=1 SV=1
9	Q99J56	2.76e-34	125	251	0.302	0.283	DERL1_MOUSE Derlin-1 OS=Mus musculus OX=10090 GN=Derl1 PE=1 SV=1
10	Q9VQ57	9.02e-30	113	245	0.281	0.269	DERL1_DROME Derlin-1 OS=Drosophila melanogaster OX=7227 GN=Der-1 PE=2 SV=1
11	Q93561	9.80e-26	102	245	0.277	0.265	DERL1_CAEEL Derlin-1 OS=Caenorhabditis elegans OX=6239 GN=cup-2 PE=2 SV=1
12	Q382S2	3.04e-24	99.0	253	0.277	0.257	Q382S2_TRYB2 Derlin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4430 PE=3 SV=1
13	O94458	5.27e-22	91.3	190	0.251	0.311	YFFH_SCHPO Uncharacterized derlin-like protein C1687.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1687.17c PE=3 SV=2
14	Q386J4	4.86e-20	86.7	205	0.230	0.263	Q386J4_TRYB2 Derlin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0670 PE=3 SV=1
15	Q9Y7Y0	7.84e-15	73.2	224	0.260	0.272	YGR8_SCHPO Uncharacterized derlin-like protein C365.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC365.08c PE=3 SV=1
16	E5RGY0	1.39e-13	68.2	151	0.157	0.245	E5RGY0_HUMAN Derlin OS=Homo sapiens OX=9606 GN=DERL1 PE=1 SV=1
17	B4E1G1	6.07e-10	58.2	151	0.115	0.179	B4E1G1_HUMAN Derlin OS=Homo sapiens OX=9606 GN=DERL1 PE=1 SV=1
18	Q12743	8.21e-10	60.1	341	0.183	0.126	DFM1_YEAST DER1-like family member protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFM1 PE=1 SV=1
19	P38307	6.49e-07	50.8	211	0.204	0.227	DER1_YEAST Degradation in the endoplasmic reticulum protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DER1 PE=1 SV=3
20	Q8IKV3	0.004	40.0	354	0.162	0.107	Q8IKV3_PLAF7 Derlin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1452300 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04511 DER1	2.5e-74	260.9	Der1-like family
2	PF01277 Oleosin	44	15.2	Oleosin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9483.ENSCJAP00000019705

Rank	PPI partner	STRING score	Description
1	9483.ENSCJAP00000019533	0.945	Endoplasmic reticulum lectin 1
2	9483.ENSCJAP00000012770	0.917	Osteosarcoma amplified 9, endoplasmic reticulum lectin
3	9483.ENSCJAP00000031721	0.869	SEL1L ERAD E3 ligase adaptor subunit
4	9483.ENSCJAP00000045309	0.826	Derlin
5	9483.ENSCJAP00000020826	0.802	Derlin
6	9483.ENSCJAP00000003747	0.796	Spermatogenesis-associated protein 5-like protein 1
7	9483.ENSCJAP00000016575	0.796	Valosin containing protein
8	9483.ENSCJAP00000049561	0.796	Spermatogenesis associated 5
9	9483.ENSCJAP00000001283	0.794	Ring finger protein 139
10	9483.ENSCJAP00000004420	0.776	Synoviolin 1
11	9483.ENSCJAP00000029242	0.773	alpha-1,2-Mannosidase
12	9483.ENSCJAP00000002837	0.764	Nuclear protein localization 4 homolog (S. cerevisiae)
13	9483.ENSCJAP00000008551	0.731	SEL1L2 ERAD E3 ligase adaptor subunit
14	9483.ENSCJAP00000010903	0.731	LRP2 binding protein
15	9483.ENSCJAP00000033688	0.731	KIAA0141
16	9483.ENSCJAP00000039209	0.731	SEL1L family member 3
17	9483.ENSCJAP00000017495	0.711	Ring finger protein, transmembrane 2
18	9483.ENSCJAP00000023332	0.711	Uncharacterized protein
19	9483.ENSCJAP00000023381	0.711	E3 ubiquitin-protein ligase AMFR
20	9483.ENSCJAP00000023973	0.711	Checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043021	1.000	ribonucleoprotein complex binding
GO:0005047	0.634	signal recognition particle binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.991	cellular metabolic process
GO:0036503	0.990	ERAD pathway
GO:0044260	0.984	cellular macromolecule metabolic process
GO:0065007	0.972	biological regulation
GO:0035966	0.969	response to topologically incorrect protein
GO:0006986	0.964	response to unfolded protein
GO:0050794	0.963	regulation of cellular process
GO:0044265	0.946	cellular macromolecule catabolic process
GO:0007154	0.940	cell communication
GO:0007165	0.933	signal transduction
GO:0035967	0.927	cellular response to topologically incorrect protein
GO:0019941	0.887	modification-dependent protein catabolic process
GO:0030433	0.879	ubiquitin-dependent ERAD pathway
GO:0034620	0.877	cellular response to unfolded protein
GO:0030968	0.812	endoplasmic reticulum unfolded protein response
GO:0051179	0.613	localization
GO:0048519	0.613	negative regulation of biological process
GO:0048523	0.600	negative regulation of cellular process
GO:0043412	0.499	macromolecule modification
GO:0036211	0.489	protein modification process
GO:0009100	0.448	glycoprotein metabolic process
GO:0051234	0.419	establishment of localization
GO:0006810	0.404	transport
GO:0032879	0.350	regulation of localization
GO:0060341	0.306	regulation of cellular localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.999	endoplasmic reticulum membrane
GO:0032991	0.757	protein-containing complex
GO:0043232	0.496	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]