StarFunc result for job id Q96Q89

User Input

>input (1820 residues)
MESNFNQEGVPRPSYVFSADPIARPSEINFDGIKLDLSHEFSLVAPNTEANSFESKDYLQ
VCLRIRPFTQSEKELESEGCVHILDSQTVVLKEPQCILGRLSEKSSGQMAQKFSFSKVFG
PATTQKEFFQGCIMQPVKDLLKGQSRLIFTYGLTNSGKTYTFQGTEENIGILPRTLNVLF
DSLQERLYTKMNLKPHRSREYLRLSSEQEKEEIASKSALLRQIKEVTVHNDSDDTLYGSL
TNSLNISEFEESIKDYEQANLNMANSIKFSVWVSFFEIYNEYIYDLFVPVSSKFQKRKML
RLSQDVKGYSFIKDLQWIQVSDSKEAYRLLKLGIKHQSVAFTKLNNASSRSHSIFTVKIL
QIEDSEMSRVIRVSELSLCDLAGSERTMKTQNEGERLRETGNINTSLLTLGKCINVLKNS
EKSKFQQHVPFRESKLTHYFQSFFNGKGKICMIVNISQCYLAYDETLNVLKFSAIAQKVC
VPDTLNSSQEKLFGPVKSSQDVSLDSNSNSKILNVKRATISWENSLEDLMEDEDLVEELE
NAEETQNVETKLLDEDLDKTLEENKAFISHEEKRKLLDLIEDLKKKLINEKKEKLTLEFK
IREEVTQEFTQYWAQREADFKETLLQEREILEENAERRLAIFKDLVGKCDTREEAAKDIC
ATKVETEETHNYVGFEDIIDSLQDNVADIKKQAEIAHLYIASLPDPQEATACLELKFNQI
KAELAKTKGELIKTKEELKKRENESDSLIQELETSNKKIITQNQRIKELINIIDQKEDTI
NEFQNLKSHMENTFKCNDKADTSSLIINNKLICNETVEVPKDSKSKICSERKRVNENELQ
QDEPPAKKGSIHVSSAITEDQKKSEEVRPNIAEIEDIRVLQENNEGLRAFLLTIENELKN
EKEEKAELNKQIVHFQQELSLSEKKNLTLSKEVQQIQSNYDIAIAELHVQKSKNQEQEEK
IMKLSNEIETATRSITNNVSQIKLMHTKIDELRTLDSVSQISNIDLLNLRDLSNGSEEDN
LPNTQLDLLGNDYLVSKQVKEYRIQEPNRENSFHSSIEAIWEECKEIVKASSKKSHQIEE
LEQQIEKLQAEVKGYKDENNRLKEKEHKNQDDLLKEKETLIQQLKEELQEKNVTLDVQIQ
HVVEGKRALSELTQGVTCYKAKIKELETILETQKVECSHSAKLEQDILEKESIILKLERN
LKEFQEHLQDSVKNTKDLNVKELKLKEEITQLTNNLQDMKHLLQLKEEEEETNRQETEKL
KEELSASSARTQNLKADLQRKEEDYADLKEKLTDAKKQIKQVQKEVSVMRDEDKLLRIKI
NELEKKKNQCSQELDMKQRTIQQLKEQLNNQKVEEAIQQYERACKDLNVKEKIIEDMRMT
LEEQEQTQVEQDQVLEAKLEEVERLATELEKWKEKCNDLETKNNQRSNKEHENNTDVLGK
LTNLQDELQESEQKYNADRKKWLEEKMMLITQAKEAENIRNKEMKKYAEDRERFFKQQNE
MEILTAQLTEKDSDLQKWREERDQLVAALEIQLKALISSNVQKDNEIEQLKRIISETSKI
ETQIMDIKPKRISSADPDKLQTEPLSTSFEISRNKIEDGSVVLDSCEVSTENDQSTRFPK
PELEIQFTPLQPNKMAVKHPGCTTPVTVKIPKARKRKSNEMEEDLVKCENKKNATPRTNL
KFPISDDRNSSVKKEQKVAIRPSSKKTYSLRSQASIIGVNLATKKKEGTLQKFGDFLQHS
PSILQSKAKKIIETMSSSKLSNVEASKENVSQPKRAKRKLYTSEISSPIDISGQVILMDQ
KMKESDHQIIKRRLRTKTAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80WE4	0.259	0.265	0.000	1774	0.721	0.740	Q80WE4.pdb.gz	KI20B_MOUSE Kinesin-like protein KIF20B OS=Mus musculus OX=10090 GN=Kif20b PE=1 SV=3
2	AFDB:Q96Q89	1.000	1.000	0.000	1820	1.000	1.000	Q96Q89.pdb.gz	KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens OX=9606 GN=KIF20B PE=1 SV=3
3	AFDB:Q387X3	0.194	0.208	1.273E-31	1682	0.167	0.181	Q387X3.pdb.gz	Q387X3_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0990 PE=3 SV=1
4	AFDB:Q6P9P6	0.178	0.294	7.334E-29	1052	0.082	0.142	Q6P9P6.pdb.gz	KIF11_MOUSE Kinesin-like protein KIF11 OS=Mus musculus OX=10090 GN=Kif11 PE=1 SV=1
5	AFDB:P28025	0.172	0.284	9.184E-29	1067	0.086	0.147	P28025.pdb.gz	KI11B_XENLA Kinesin-like protein KIF11-B OS=Xenopus laevis OX=8355 GN=kif11-b PE=1 SV=2
6	AFDB:Q9VKH9	0.157	0.148	9.716E-29	1931	0.173	0.163	Q9VKH9.pdb.gz	Q9VKH9_DROME CENP-ana, isoform A OS=Drosophila melanogaster OX=7227 GN=cana PE=3 SV=2
7	AFDB:Q57UV7	0.167	0.205	1.612E-28	1456	0.162	0.203	Q57UV7.pdb.gz	Q57UV7_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.660 PE=3 SV=1
8	AFDB:Q57UD0	0.175	0.177	1.446E-27	1803	0.152	0.154	Q57UD0.pdb.gz	Q57UD0_TRYB2 Kinesin K39, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.6C8.180 PE=3 SV=1
9	AFDB:Q6RT24	0.178	0.134	4.453E-27	2474	0.172	0.127	Q6RT24.pdb.gz	CENPE_MOUSE Centromere-associated protein E OS=Mus musculus OX=10090 GN=Cenpe PE=1 SV=1
10	AFDB:P17120	0.170	0.257	1.451E-26	1184	0.085	0.130	P17120.pdb.gz	BIMC_EMENI Kinesin-like protein bimC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bimC PE=2 SV=2
11	PDB:7wrgA	0.164	0.357	1.739E-25	812	0.058	0.129	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.156	0.354	4.557E-23	783	0.056	0.130	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.151	0.397	1.327E-22	670	0.054	0.146	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:5j6hA	0.028	0.124	3.151E-1	275	0.006	0.040	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
15	PDB:6rkwD	0.033	0.062	3.526E-1	781	0.021	0.049	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
16	PDB:6ylgb	0.032	0.070	6.547E-1	613	0.030	0.088	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
17	PDB:5c0wJ	0.027	0.041	9.175E-1	970	0.009	0.018	5c0wJ.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
18	PDB:7d56C	0.024	0.050	9.175E-1	640	0.010	0.028	7d56C.pdb.gz	Structures of human peptidylarginine deiminase type III provide insights into substrate recognition and inhibitor design.
19	PDB:2wkpA	0.040	0.121	9.706E-1	320	0.019	0.106	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
20	PDB:7uy7B	0.021	0.071	9.706E-1	291	0.015	0.096	7uy7B.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80WE4	0.0	2575	1774	0.723	0.742	KI20B_MOUSE Kinesin-like protein KIF20B OS=Mus musculus OX=10090 GN=Kif20b PE=1 SV=3
2	Q96Q89	0.0	3674	1820	1.000	1.000	KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens OX=9606 GN=KIF20B PE=1 SV=3
3	O95235	2.91e-120	404	890	0.149	0.306	KI20A_HUMAN Kinesin-like protein KIF20A OS=Homo sapiens OX=9606 GN=KIF20A PE=1 SV=1
4	F1QDF0	8.03e-116	393	921	0.129	0.255	F1QDF0_DANRE Kinesin-like protein OS=Danio rerio OX=7955 GN=wu:fi34h02 PE=1 SV=1
5	Q502K6	1.37e-114	389	921	0.128	0.253	Q502K6_DANRE Kinesin-like protein OS=Danio rerio OX=7955 GN=kif20a PE=2 SV=1
6	Q9PUU5	2.09e-69	254	867	0.085	0.178	Q9PUU5_DANRE Kinesin-like protein OS=Danio rerio OX=7955 GN=zMKLP1 PE=1 SV=1
7	E9Q5G3	2.94e-69	255	953	0.088	0.169	KIF23_MOUSE Kinesin-like protein KIF23 OS=Mus musculus OX=10090 GN=Kif23 PE=1 SV=1
8	H7BYN4	1.13e-66	248	952	0.085	0.162	H7BYN4_HUMAN Kinesin-like protein OS=Homo sapiens OX=9606 GN=KIF23 PE=1 SV=1
9	A0A286Y967	1.14e-66	246	882	0.085	0.175	A0A286Y967_DANRE Kinesin-like protein OS=Danio rerio OX=7955 GN=cb738 PE=1 SV=1
10	Q02241	1.60e-66	247	960	0.085	0.160	KIF23_HUMAN Kinesin-like protein KIF23 OS=Homo sapiens OX=9606 GN=KIF23 PE=1 SV=3
11	A0A2U3TZL8	1.39e-64	239	810	0.086	0.194	A0A2U3TZL8_HUMAN Kinesin-like protein OS=Homo sapiens OX=9606 GN=KIF23 PE=1 SV=1
12	Q8SXT9	3.16e-61	230	887	0.082	0.169	Q8SXT9_DROME Kinesin-like protein OS=Drosophila melanogaster OX=7227 GN=pav PE=2 SV=1
13	Q9VZF5	3.43e-61	230	887	0.082	0.169	Q9VZF5_DROME Kinesin-like protein OS=Drosophila melanogaster OX=7227 GN=pav PE=1 SV=1
14	O62528	3.55e-61	230	886	0.082	0.169	O62528_DROME Kinesin-like protein OS=Drosophila melanogaster OX=7227 GN=pav PE=2 SV=1
15	G5EC43	9.83e-56	211	772	0.085	0.201	G5EC43_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=zen-4 PE=1 SV=1
16	G5EG83	1.18e-55	211	775	0.085	0.200	G5EG83_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=zen-4 PE=1 SV=1
17	Q8MQ03	1.37e-55	211	787	0.086	0.198	Q8MQ03_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=zen-4 PE=1 SV=2
18	Q9V877	3.94e-55	206	628	0.076	0.220	SUB_DROME Kinesin-like protein subito OS=Drosophila melanogaster OX=7227 GN=sub PE=1 SV=1
19	Q8MQ04	4.40e-55	209	777	0.086	0.201	Q8MQ04_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=zen-4 PE=1 SV=1
20	Q1MTQ7	1.51e-41	166	633	0.070	0.202	KLP9_SCHPO Kinesin-like motor protein 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=klp9 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00225 Kinesin	1e-90	315.6	Kinesin motor domain
2	PF16796 Microtub_bd	4.6e-09	47.8	Microtubule binding
3	PF13414 TPR_11	4.4e+02	12.0	TPR repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360793

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000404190	0.971	Rac GTPase-activating protein 1
2	9606.ENSP00000260731	0.959	Kinesin-like protein KIF11
3	9606.ENSP00000265148	0.929	Centromere-associated protein E
4	9606.ENSP00000356379	0.926	Abnormal spindle-like microcephaly-associated protein
5	9606.ENSP00000302530	0.903	Mitotic checkpoint serine/threonine-protein kinase BUB1
6	9606.ENSP00000358813	0.886	Dual specificity protein kinase TTK
7	9606.ENSP00000363524	0.879	Chromosome-associated kinesin KIF4A
8	9606.ENSP00000324020	0.873	Kinesin-like protein KIF15
9	9606.ENSP00000288207	0.847	G2/mitotic-specific cyclin-B2
10	9606.ENSP00000263181	0.840	Kinesin-like protein KIF18A
11	9606.ENSP00000260363	0.838	Kinesin-like protein KIF23
12	9606.ENSP00000412292	0.836	DEP domain-containing protein 1A
13	9606.ENSP00000256442	0.835	G2/mitotic-specific cyclin-B1
14	9606.ENSP00000287598	0.834	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
15	9606.ENSP00000361298	0.834	Kinesin-like protein KIF2C
16	9606.ENSP00000216911	0.831	Aurora kinase A
17	9606.ENSP00000286398	0.830	Structural maintenance of chromosomes protein 2
18	9606.ENSP00000251496	0.827	Condensin complex subunit 3
19	9606.ENSP00000378699	0.804	Cyclin-dependent kinase 1
20	9606.ENSP00000274026	0.803	Cyclin-A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003777	1.000	microtubule motor activity
GO:0008092	0.995	cytoskeletal protein binding
GO:0008017	0.991	microtubule binding
GO:0003824	0.988	catalytic activity
GO:0008574	0.971	plus-end-directed microtubule motor activity
GO:0042802	0.926	identical protein binding
GO:0016817	0.926	hydrolase activity, acting on acid anhydrides
GO:0016887	0.917	ATP hydrolysis activity
GO:0050699	0.890	WW domain binding
GO:0046983	0.888	protein dimerization activity
GO:0042803	0.873	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010564	0.990	regulation of cell cycle process
GO:0048522	0.982	positive regulation of cellular process
GO:0090068	0.961	positive regulation of cell cycle process
GO:0032465	0.927	regulation of cytokinesis
GO:0051781	0.923	positive regulation of cell division
GO:0042127	0.859	regulation of cell population proliferation
GO:0032467	0.839	positive regulation of cytokinesis
GO:0009987	0.831	cellular process
GO:0008284	0.693	positive regulation of cell population proliferation
GO:0071840	0.601	cellular component organization or biogenesis
GO:0016043	0.587	cellular component organization
GO:0006996	0.435	organelle organization
GO:0007049	0.434	cell cycle
GO:0022402	0.388	cell cycle process
GO:0000278	0.337	mitotic cell cycle
GO:0007017	0.302	microtubule-based process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005819	1.000	spindle
GO:0005829	0.999	cytosol
GO:0005654	0.998	nucleoplasm
GO:0030496	0.991	midbody
GO:0051233	0.968	spindle midzone
GO:0005813	0.898	centrosome
GO:0072686	0.843	mitotic spindle
GO:0000922	0.768	spindle pole
GO:0016020	0.726	membrane
GO:0005730	0.719	nucleolus
GO:0045171	0.568	intercellular bridge
GO:0032991	0.467	protein-containing complex
GO:0097431	0.383	mitotic spindle pole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.3	0.971	plus-end-directed kinesin ATPase.
EC:3.6.-.-	0.926	Acting on acid anhydrides.
RHEA:13065	0.917	ATP + H2O = ADP + H(+) + phosphate

[back to server]