StarFunc result for job id Q96Q91

User Input

>input (983 residues)
MEMKLPGQEGFEASSAPRNIPSGELDSNPDPGTGPSPDGPSDTESKELGVPKDPLLFIQL
NELLGWPQALEWRETGSSSASLLLDMGEMPSITLSTHLHHRWVLFEEKLEVAAGRWSAPH
VPTLALPSLQKLRSLLAEGLVLLDCPAQSLLELVEQVTRVESLSPELRGQLQALLLQRPQ
HYNQTTGTRPCWGSTHPRKASDNEEAPLREQCQNPLRQKLPPGAEAGTVLAGELGFLAQP
LGAFVRLRNPVVLGSLTEVSLPSRFFCLLLGPCMLGKGYHEMGRAAAVLLSDPQFQWSVR
RASNLHDLLAALDAFLEEVTVLPPGRWDPTARIPPPKCLPSQHKRLPSQQREIRGPAVPR
LTSAEDRHRHGPHAHSPELQRTGRLFGGLIQDVRRKVPWYPSDFLDALHLQCFSAVLYIY
LATVTNAITFGGLLGDATDGAQGVLESFLGTAVAGAAFCLMAGQPLTILSSTGPVLVFER
LLFSFSRDYSLDYLPFRLWVGIWVATFCLVLVATEASVLVRYFTRFTEEGFCALISLIFI
YDAVGKMLNLTHTYPIQKPGSSAYGCLCQYPGPGGNESQWIRTRPKDRDDIVSMDLGLIN
ASLLPPPECTRQGGHPRGPGCHTVPDIAFFSLLLFLTSFFFAMALKCVKTSRFFPSVVRK
GLSDFSSVLAILLGCGLDAFLGLATPKLMVPREFKPTLPGRGWLVSPFGANPWWWSVAAA
LPALLLSILIFMDQQITAVILNRMEYRLQKGAGFHLDLFCVAVLMLLTSALGLPWYVSAT
VISLAHMDSLRRESRACAPGERPNFLGIREQRLTGLVVFILTGASIFLAPVLKFIPMPVL
YGIFLYMGVAALSSIQFTNRVKLLLMPAKHQPDLLLLRHVPLTRVHLFTAIQLACLGLLW
IIKSTPAAIIFPLMLLGLVGVRKALERVFSPQELLWLDELMPEEERSIPEKGLEPEHSFS
GSDSEDSELMYQPKAPEINISVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8K4V2	0.861	0.887	0.000	953	0.807	0.832	Q8K4V2.pdb.gz	B3A4_RAT Anion exchange protein 4 OS=Rattus norvegicus OX=10116 GN=Slc4a9 PE=1 SV=1
2	AFDB:Q96Q91	1.000	1.000	0.000	983	1.000	1.000	Q96Q91.pdb.gz	B3A4_HUMAN Anion exchange protein 4 OS=Homo sapiens OX=9606 GN=SLC4A9 PE=2 SV=2
3	AFDB:E9PUP3	0.658	0.693	3.483E-104	929	0.778	0.823	E9PUP3.pdb.gz	E9PUP3_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
4	AFDB:Q8BUG8	0.481	0.524	5.309E-92	880	0.709	0.792	Q8BUG8.pdb.gz	Q8BUG8_MOUSE Solute carrier family 4, sodium bicarbonate cotransporter, member 9 OS=Mus musculus OX=10090 GN=Slc4a9 PE=2 SV=1
5	AFDB:F1QHT2	0.774	0.707	3.874E-88	1082	0.511	0.464	F1QHT2.pdb.gz
6	AFDB:O88343	0.776	0.711	7.972E-87	1079	0.514	0.468	O88343.pdb.gz	S4A4_MOUSE Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus OX=10090 GN=Slc4a4 PE=1 SV=2
7	AFDB:O13134	0.779	0.742	2.029E-86	1035	0.499	0.474	O13134.pdb.gz	S4A4_AMBTI Electrogenic sodium bicarbonate cotransporter 1 OS=Ambystoma tigrinum OX=8305 GN=SLC4A4 PE=2 SV=1
8	AFDB:A0A2R8PYB9	0.543	0.482	1.373E-85	1114	0.513	0.452	A0A2R8PYB9.pdb.gz
9	AFDB:Q9BY07	0.538	0.468	3.015E-82	1137	0.477	0.412	Q9BY07.pdb.gz	S4A5_HUMAN Electrogenic sodium bicarbonate cotransporter 4 OS=Homo sapiens OX=9606 GN=SLC4A5 PE=2 SV=2
10	AFDB:E9Q3M5	0.541	0.479	3.603E-82	1116	0.478	0.421	E9Q3M5.pdb.gz	S4A5_MOUSE Electrogenic sodium bicarbonate cotransporter 4 OS=Mus musculus OX=10090 GN=Slc4a5 PE=1 SV=1
11	PDB:8cs9g	0.507	0.595	6.919E-56	832	0.315	0.373	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:7tvzA	0.544	0.617	2.654E-54	850	0.320	0.371	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
13	PDB:6caaA	0.451	0.914	2.914E-36	477	0.311	0.642	6caaA.pdb.gz
14	PDB:4yzfA	0.466	0.953	1.141E-32	475	0.207	0.427	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
15	PDB:5l25A	0.327	0.741	2.604E-12	399	0.100	0.246	5l25A.pdb.gz
16	PDB:7lguA	0.307	0.428	6.901E-8	680	0.063	0.091	7lguA.pdb.gz	Molecular mechanism of prestin electromotive signal amplification.
17	PDB:7ch1A	0.277	0.393	4.719E-6	640	0.069	0.106	7ch1A.pdb.gz	Structural insights into the gating mechanism of human SLC26A9 mediated by its C-terminal sequence.
18	PDB:5i6cA	0.250	0.445	7.437E-5	480	0.071	0.146	5i6cA.pdb.gz	Structure of eukaryotic purine/H(+) symporter UapA suggests a role for homodimerization in transport activity.
19	PDB:3qe7A	0.259	0.532	1.326E-4	407	0.069	0.167	3qe7A.pdb.gz	Structure and mechanism of the uracil transporter UraA
20	PDB:1a6jB	0.079	0.443	2.522E-2	157	0.018	0.115	1a6jB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QD45	927	1073	0.509	0.466	A0A2R8QD45_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=id:ibd2520 PE=1 SV=1
2	A0A494BA31	1484	952	0.801	0.827	B3A4_MOUSE Anion exchange protein 4 OS=Mus musculus OX=10090 GN=Slc4a9 PE=1 SV=1
3	A0A494BAI0	1219	871	0.667	0.753	A0A494BAI0_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
4	A0A494BAK5	1325	821	0.703	0.842	A0A494BAK5_MOUSE Anion exchange protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
5	A0A494BBC3	1406	918	0.770	0.825	A0A494BBC3_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
6	A9NIM6	562	1232	0.369	0.295	A9NIM6_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2.1 PE=1 SV=1
7	B3WFV9	657	1215	0.342	0.277	B3WFV9_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=2
8	E9PUP3	1425	929	0.777	0.822	E9PUP3_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
9	E9Q3M5	849	1116	0.471	0.415	S4A5_MOUSE Electrogenic sodium bicarbonate cotransporter 4 OS=Mus musculus OX=10090 GN=Slc4a5 PE=1 SV=1
10	G5EC65	692	1119	0.396	0.348	G5EC65_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
11	G5EDF4	691	1161	0.395	0.334	G5EDF4_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
12	M9PB59	714	1134	0.407	0.353	M9PB59_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
13	M9PB60	710	1126	0.405	0.353	M9PB60_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
14	M9PC92	712	1086	0.401	0.363	M9PC92_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
15	M9PC95	672	1046	0.355	0.334	M9PC95_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
16	M9PCF0	672	1067	0.355	0.327	M9PCF0_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
17	M9PCT2	720	1027	0.404	0.387	M9PCT2_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
18	M9PF01	680	1053	0.403	0.376	M9PF01_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
19	O13134	935	1035	0.515	0.489	S4A4_AMBTI Electrogenic sodium bicarbonate cotransporter 1 OS=Ambystoma tigrinum OX=8305 GN=SLC4A4 PE=2 SV=1
20	O88343	940	1079	0.504	0.459	S4A4_MOUSE Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus OX=10090 GN=Slc4a4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07565 Band_3_cyto	1.4e-49	180.9	Band 3 cytoplasmic domain
2	PF00955 HCO3_cotransp	6.7e-203	686.7	HCO3- transporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427661

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354085	0.764	Ankyrin repeat and KH domain-containing protein 1
2	9606.ENSP00000353557	0.674	Solute carrier family 35 member F1
3	9606.ENSP00000354003	0.663	Glycophorin-A
4	9606.ENSP00000481301	0.618	Sodium-coupled neutral amino acid transporter 3
5	9606.ENSP00000311336	0.617	Phospholipid-transporting ATPase IK
6	9606.ENSP00000378920	0.617	Solute carrier family 26 member 6
7	9606.ENSP00000265715	0.594	Pendrin
8	9606.ENSP00000344504	0.593	Histone H1.0
9	9606.ENSP00000308472	0.576	Eukaryotic translation initiation factor 4E-binding protein 3
10	9606.ENSP00000370639	0.574	Acetylserotonin O-methyltransferase
11	9606.ENSP00000309504	0.570	Anion exchange transporter
12	9606.ENSP00000345873	0.566	Chloride anion exchanger
13	9606.ENSP00000250615	0.563	Serotonin N-acetyltransferase
14	9606.ENSP00000379174	0.560	DNA-directed DNA/RNA polymerase mu
15	9606.ENSP00000365005	0.534	Mitogen-activated protein kinase kinase kinase 19
16	9606.ENSP00000356102	0.520	Solute carrier family 26 member 9
17	9606.ENSP00000416508	0.515	Probable cation-transporting ATPase 13A3
18	9606.ENSP00000320217	0.501	Solute carrier family 26 member 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008510	1.000	sodium:bicarbonate symporter activity
GO:0005515	0.979	protein binding
GO:0015103	0.907	inorganic anion transmembrane transporter activity
GO:0015297	0.806	antiporter activity
GO:0008509	0.556	monoatomic anion transmembrane transporter activity
GO:0015108	0.430	chloride transmembrane transporter activity
GO:0005452	0.308	solute:inorganic anion antiporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.985	localization
GO:0051234	0.970	establishment of localization
GO:0006810	0.960	transport
GO:0019755	0.908	one-carbon compound transport
GO:0015711	0.822	organic anion transport
GO:0006811	0.643	monoatomic ion transport
GO:0065007	0.499	biological regulation
GO:0009987	0.495	cellular process
GO:0050789	0.312	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005886	0.993	plasma membrane
GO:0045177	0.527	apical part of cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:28695	1.000	hydrogencarbonate(in) = hydrogencarbonate(out)
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)
RHEA:29823	0.430	chloride(in) = chloride(out)

[back to server]