StarFunc result for job id Q96QB1

User Input

>input (1528 residues)
MSVAIRKRSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVS
LPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLC
LTDDKQVLNTQGQKTSGQHMIQGAGSLEKALPIIQSNQVSSNSWGIAGETELALVKESGE
RKVTDSISKSLELCNEISLSEIKDAPKVNAVDTLNVKDIAPEKQLLNSAVIAQQRRKPDP
PKDENERSTCNVVQNEFLDTPCTNRGLPLLKTDFGSCLLQPPSCPNGMSAENGLEKSGFS
QHQNKSPPKVKAEDGMQCLQLKETLATQEPTDNQVRLRKRKEIREDRDRARLDSMVLLIM
KLDQLDQDIENALSTSSSPSGTPTNLRRHVPDLESGSESGADTISVNQTRVNLSSDTEST
DLPSSTPVANSGTKPKTTAIQGISEKEKAEIEAKEACDWLRATGFPQYAQLYEDFLFPID
ISLVKREHDFLDRDAIEALCRRLNTLNKCAVMKLEISPHRKRSDDSDEDEPCAISGKWTF
QRDSKRWSRLEEFDVFSPKQDLVPGSPDDSHPKDGPSPGGTLMDLSERQEVSSVRSLSST
GSLPSHAPPSEDAATPRTNSVISVCSSSNLAGNDDSFGSLPSPKELSSFSFSMKGHEKTA
KSKTRSLLKRMESLKLKSSHHSKHKAPSKLGLIISGPILQEGMDEEKLKQLNCVEISALN
GNRINVPMVRKRSVSNSTQTSSSSSQSETSSAVSTPSPVTRTRSLSACNKRVGMYLEGFD
PFNQSTFNNVVEQNFKNRESYPEDTVFYIPEDHKPGTFPKALTNGSFSPSGNNGSVNWRT
GSFHGPGHISLRRENSSDSPKELKRRNSSSSMSSRLSIYDNVPGSILYSSSGDLADLENE
DIFPELDDILYHVKGMQRIVNQWSEKFSDEGDSDSALDSVSPCPSSPKQIHLDVDNDRTT
PSDLDSTGNSLNEPEEPSEIPERRDSGVGASLTRSNRHRLRWHSFQSSHRPSLNSVSLQI
NCQSVAQMNLLQKYSLLKLTALLEKYTPSNKHGFSWAVPKFMKRIKVPDYKDRSVFGVPL
TVNVQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNEGAIDCVNYEG
QSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAAIMLLPDENREV
LQTLLYFLSDVTAAVKENQMTPTNLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQ
KDLNENLAATQGLAHMIAECKKLFQVPEEMSRCRNSYTEQELKPLTLEALGHLGNDDSAD
YQHFLQDCVDGLFKEVKEKFKGWVSYSTSEQAELSYKKVSEGPPLRLWRSVIEVPAVPEE
ILKRLLKEQHLWDVDLLDSKVIEILDSQTEIYQYVQNSMAPHPARDYVVLRTWRTNLPKG
ACALLLTSVDHDRAPVVGVRVNVLLSRYLIEPCGPGKSKLTYMCRVDLRGHMPEWYTKSF
GHLCAAEVVKIRDSFSNQNTETKDTKSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96QB1	1.000	1.000	0.000	1528	1.000	1.000	Q96QB1.pdb.gz	RHG07_HUMAN Rho GTPase-activating protein 7 OS=Homo sapiens OX=9606 GN=DLC1 PE=1 SV=4
2	AFDB:A8JR05	0.324	0.215	7.613E-56	2351	0.266	0.173	A8JR05.pdb.gz	A8JR05_DROME Crossveinless c, isoform C OS=Drosophila melanogaster OX=7227 GN=cv-c PE=4 SV=1
3	PDB:2r55A	0.121	0.797	5.970E-11	208	0.024	0.178	2r55A.pdb.gz
4	PDB:6r3vA	0.116	0.838	1.524E-10	198	0.038	0.293	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
5	PDB:6serA	0.120	0.654	1.927E-10	245	0.032	0.200	6serA.pdb.gz
6	PDB:3cxlA	0.121	0.444	2.552E-10	402	0.036	0.137	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
7	PDB:5brlA	0.124	0.824	3.381E-10	210	0.021	0.152	5brlA.pdb.gz
8	PDB:6l1dA	0.121	0.842	4.694E-10	200	0.020	0.155	6l1dA.pdb.gz
9	AFDB:P34288	0.123	0.118	3.122E-9	1605	0.124	0.118	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
10	PDB:5jcpA	0.105	0.407	9.425E-9	361	0.033	0.139	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
11	AFDB:Q5AMQ3	0.108	0.139	7.214E-8	1176	0.115	0.150	Q5AMQ3.pdb.gz	Q5AMQ3_CANAL Rga2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RGA2 PE=4 SV=1
12	PDB:1xa6A	0.122	0.450	8.530E-8	399	0.033	0.128	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
13	AFDB:Q9VDE9	0.119	0.135	1.600E-7	1330	0.125	0.144	Q9VDE9.pdb.gz	Q9VDE9_DROME FI04035p OS=Drosophila melanogaster OX=7227 GN=RhoGAP93B PE=2 SV=2
14	AFDB:P39083	0.107	0.159	4.282E-7	1007	0.103	0.156	P39083.pdb.gz	RGA1_YEAST Rho-type GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA1 PE=1 SV=1
15	PDB:5c2kA	0.106	0.405	9.760E-7	382	0.025	0.099	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
16	PDB:1ln1A	0.112	0.699	1.971E-6	203	0.023	0.172	1ln1A.pdb.gz	Structure of human phosphatidylcholine transfer protein in complex with its ligand.
17	AFDB:E9Q7D5	0.055	0.055	6.083E-3	1581	0.152	0.147	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
18	AFDB:A0A0R4IWL6	0.042	0.051	1.288E-2	1152	0.109	0.145	A0A0R4IWL6.pdb.gz	A0A0R4IWL6_DANRE Pumilio RNA-binding family member 1 OS=Danio rerio OX=7955 GN=fb96a03 PE=1 SV=2
19	AFDB:A8DZ29	0.052	0.046	1.628E-2	1919	0.128	0.102	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
20	AFDB:Q5T1Z8	0.051	0.058	3.784E-2	1224	0.117	0.146	Q5T1Z8.pdb.gz	Q5T1Z8_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q63744	0.0	1996	1091	0.654	0.917	RHG07_RAT Rho GTPase-activating protein 7 OS=Rattus norvegicus OX=10116 GN=Dlc1 PE=1 SV=3
2	Q923Q2	0.0	1112	1113	0.395	0.542	STA13_MOUSE StAR-related lipid transfer protein 13 OS=Mus musculus OX=10090 GN=Stard13 PE=1 SV=5
3	Q96QB1	0.0	3163	1528	1.000	1.000	RHG07_HUMAN Rho GTPase-activating protein 7 OS=Homo sapiens OX=9606 GN=DLC1 PE=1 SV=4
4	Q9R0Z9	0.0	1986	1092	0.654	0.915	RHG07_MOUSE Rho GTPase-activating protein 7 OS=Mus musculus OX=10090 GN=Dlc1 PE=1 SV=2
5	Q9Y3M8	0.0	1098	1113	0.396	0.544	STA13_HUMAN StAR-related lipid transfer protein 13 OS=Homo sapiens OX=9606 GN=STARD13 PE=1 SV=2
6	Q8SY28	3.98e-144	471	1017	0.156	0.234	Q8SY28_DROME RE02250p OS=Drosophila melanogaster OX=7227 GN=cv-c PE=2 SV=1
7	Q9VFK2	8.64e-144	469	1017	0.155	0.233	Q9VFK2_DROME Crossveinless c, isoform A OS=Drosophila melanogaster OX=7227 GN=cv-c PE=2 SV=2
8	A8JR05	1.73e-138	476	2351	0.155	0.101	A8JR05_DROME Crossveinless c, isoform C OS=Drosophila melanogaster OX=7227 GN=cv-c PE=4 SV=1
9	Q20442	1.85e-86	313	1334	0.125	0.143	Q20442_CAEEL START domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-1 PE=1 SV=4
10	C7FZT8	3.74e-86	311	1341	0.125	0.142	C7FZT8_CAEEL START domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-1 PE=1 SV=1
11	Q20440	8.36e-86	312	1510	0.125	0.126	Q20440_CAEEL START domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-1 PE=1 SV=5
12	C0P276	1.02e-30	124	228	0.045	0.298	C0P276_CAEEL START domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-1 PE=4 SV=1
13	Q8K0Q5	2.56e-22	106	663	0.050	0.116	RHG18_MOUSE Rho GTPase-activating protein 18 OS=Mus musculus OX=10090 GN=Arhgap18 PE=1 SV=1
14	Q8N392	1.62e-20	100	663	0.040	0.092	RHG18_HUMAN Rho GTPase-activating protein 18 OS=Homo sapiens OX=9606 GN=ARHGAP18 PE=1 SV=3
15	O43182	1.55e-18	94.7	974	0.043	0.067	RHG06_HUMAN Rho GTPase-activating protein 6 OS=Homo sapiens OX=9606 GN=ARHGAP6 PE=1 SV=3
16	O54834	1.89e-18	94.4	987	0.041	0.064	RHG06_MOUSE Rho GTPase-activating protein 6 OS=Mus musculus OX=10090 GN=Arhgap6 PE=1 SV=3
17	B4DN07	2.56e-18	93.2	604	0.043	0.108	B4DN07_HUMAN Rho GTPase activating protein 6 OS=Homo sapiens OX=9606 GN=ARHGAP6 PE=1 SV=1
18	Q99N37	2.65e-18	94.0	858	0.040	0.071	RHG17_RAT Rho GTPase-activating protein 17 OS=Rattus norvegicus OX=10116 GN=Arhgap17 PE=1 SV=1
19	Q3UIA2	3.08e-18	93.6	846	0.040	0.072	RHG17_MOUSE Rho GTPase-activating protein 17 OS=Mus musculus OX=10090 GN=Arhgap17 PE=1 SV=1
20	Q58AA5	3.27e-18	88.2	245	0.037	0.233	Q58AA5_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rga-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09521 RE_NgoPII	3.3e+02	11.7	NgoPII restriction endonuclease
2	PF00620 RhoGAP	5e-37	138.5	RhoGAP domain
3	PF07647 SAM_2	9.7e-05	33.7	SAM domain (Sterile alpha motif)
4	PF15120 SPACA9	1.7e+02	13.4	Sperm acrosome-associated protein 9
5	PF01852 START	8.5e-50	180.6	START domain
6	PF20175 Tra1_central	14	15.8	Tra1 HEAT repeat central region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276297

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319756	0.992	Tensin-2
2	9606.ENSP00000171887	0.977	Tensin-1
3	9606.ENSP00000400175	0.974	Transforming protein RhoA
4	9606.ENSP00000339191	0.963	Caveolin-1
5	9606.ENSP00000430344	0.960	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
6	9606.ENSP00000312143	0.788	Tensin-3
7	9606.ENSP00000316029	0.752	Talin-1
8	9606.ENSP00000361021	0.737	Phosphatase and tensin homolog
9	9606.ENSP00000274376	0.729	Ras GTPase-activating protein 1
10	9606.ENSP00000369862	0.722	Collagen type IV alpha-3-binding protein
11	9606.ENSP00000303246	0.719	Acyl-coenzyme A thioesterase 12
12	9606.ENSP00000304032	0.719	StAR-related lipid transfer protein 5
13	9606.ENSP00000285735	0.678	Rho-related GTP-binding protein RhoC
14	9606.ENSP00000316861	0.642	cDNA FLJ54144, highly similar to Neuronal membrane glycoprotein M6-b
15	9606.ENSP00000385939	0.642	Zinc finger protein 12
16	9606.ENSP00000351614	0.641	Synapsin-3
17	9606.ENSP00000360366	0.627	Acyl-coenzyme A thioesterase 11
18	9606.ENSP00000268896	0.620	Phosphatidylcholine transfer protein
19	9606.ENSP00000272233	0.618	Rho-related GTP-binding protein RhoB
20	9606.ENSP00000348170	0.602	Haptoglobin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0042169	0.934	SH2 domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.977	cellular process
GO:0051056	0.975	regulation of small GTPase mediated signal transduction
GO:2000145	0.956	regulation of cell motility
GO:0051128	0.920	regulation of cellular component organization
GO:0043085	0.913	positive regulation of catalytic activity
GO:0048523	0.900	negative regulation of cellular process
GO:0033043	0.895	regulation of organelle organization
GO:1902903	0.892	regulation of supramolecular fiber organization
GO:0030334	0.886	regulation of cell migration
GO:0051493	0.873	regulation of cytoskeleton organization
GO:0010810	0.863	regulation of cell-substrate adhesion
GO:0051336	0.859	regulation of hydrolase activity
GO:0032956	0.850	regulation of actin cytoskeleton organization
GO:0044087	0.844	regulation of cellular component biogenesis
GO:0019220	0.829	regulation of phosphate metabolic process
GO:0048522	0.817	positive regulation of cellular process
GO:0110053	0.804	regulation of actin filament organization
GO:0051345	0.786	positive regulation of hydrolase activity
GO:0090109	0.777	regulation of cell-substrate junction assembly
GO:0110020	0.774	regulation of actomyosin structure organization
GO:0032231	0.774	regulation of actin filament bundle assembly
GO:0009968	0.761	negative regulation of signal transduction
GO:0001952	0.752	regulation of cell-matrix adhesion
GO:0051492	0.742	regulation of stress fiber assembly
GO:0080090	0.730	regulation of primary metabolic process
GO:0060255	0.726	regulation of macromolecule metabolic process
GO:0051171	0.717	regulation of nitrogen compound metabolic process
GO:0051893	0.697	regulation of focal adhesion assembly
GO:0007162	0.676	negative regulation of cell adhesion
GO:0051129	0.656	negative regulation of cellular component organization
GO:1902532	0.648	negative regulation of intracellular signal transduction
GO:0010812	0.643	negative regulation of cell-substrate adhesion
GO:0051246	0.628	regulation of protein metabolic process
GO:0050896	0.589	response to stimulus
GO:0009893	0.580	positive regulation of metabolic process
GO:2000146	0.481	negative regulation of cell motility
GO:0031399	0.467	regulation of protein modification process
GO:0051716	0.455	cellular response to stimulus
GO:0023052	0.400	signaling
GO:0007154	0.400	cell communication
GO:0071840	0.395	cellular component organization or biogenesis
GO:0050793	0.386	regulation of developmental process
GO:0035023	0.374	regulation of Rho protein signal transduction
GO:0051058	0.368	negative regulation of small GTPase mediated signal transduction
GO:0030336	0.364	negative regulation of cell migration
GO:0016043	0.363	cellular component organization
GO:0031325	0.319	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005829	0.998	cytosol
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005886	0.990	plasma membrane
GO:0030054	0.989	cell junction
GO:0070161	0.978	anchoring junction
GO:0005925	0.969	focal adhesion
GO:0005856	0.936	cytoskeleton
GO:0045121	0.932	membrane raft
GO:0015629	0.906	actin cytoskeleton
GO:0043227	0.833	membrane-bounded organelle
GO:0043231	0.776	intracellular membrane-bounded organelle
GO:0098590	0.750	plasma membrane region
GO:0120025	0.729	plasma membrane bounded cell projection
GO:0031252	0.720	cell leading edge
GO:0005634	0.720	nucleus
GO:0001726	0.490	ruffle
GO:0005938	0.477	cell cortex
GO:0031253	0.472	cell projection membrane
GO:0044853	0.439	plasma membrane raft
GO:0030864	0.417	cortical actin cytoskeleton
GO:0031981	0.402	nuclear lumen
GO:0031256	0.383	leading edge membrane
GO:0005901	0.380	caveola
GO:0032587	0.319	ruffle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]