StarFunc result for job id Q96QC0

User Input

>input (940 residues)
MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSP
EILVKFIDVGGYKLLNNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQL
SKSSEDEELRKLASVLVSDWMAVIRSQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKA
ETRAEEAPEKKREKPKSLRTTAPSHAKFRSTGLELETPSLVPVKKNASTVVVSDKYNLKP
IPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDALNSAPV
PGIKIKKKKKVLSPTAAKPSPFEGKTSTEPSTAKPSSPEPAPPSEAMDADRPGTPVPPVE
VPELMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETER
VNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWVCPRPLVLPSPLVTPGSNS
QERYIQAEREKGILQELFLNKESPHEPDPEPYEPIPPKLIPLDEECSMDETPYVETLEPG
GSGGSPDGAGGSKLPPVLANLMGSMGAGKGPQGPGGGGINVQEILTSIMGSPNSHPSEEL
LKQPDYSDKIKQMLVPHGLLGPGPIANGFPPGGPGGPKGMQHFPPGPGGPMPGPHGGPGG
PVGPRLLGPPPPPRGGDPFWDGPGDPMRGGPMRGGPGPGPGPYHRGRGGRGGNEPPPPPP
PFRGARGGRSGGGPPNGRGGPGGGMVGGGGHRPHEGPGGGMGNSSGHRPHEGPGGGMGSG
HRPHEGPGGSMGGGGGHRPHEGPGGGISGGSGHRPHEGPGGGMGAGGGHRPHEGPGGSMG
GSGGHRPHEGPGHGGPHGHRPHDVPGHRGHDHRGPPPHEHRGHDGPGHGGGGHRGHDGGH
SHGGDMSNRPVCRHFMMKGNCRYENNCAFYHPGVNGPPLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2L6I0	0.210	0.210	0.000	940	1.000	1.000	Q2L6I0.pdb.gz	Q2L6I0_HUMAN Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=2 SV=1
2	AFDB:Q80W00	0.234	0.245	4.830E-102	888	0.904	0.957	Q80W00.pdb.gz	PP1RA_MOUSE Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Mus musculus OX=10090 GN=Ppp1r10 PE=1 SV=1
3	AFDB:Q8VZM2	0.137	0.129	4.889E-6	1000	0.145	0.136	Q8VZM2.pdb.gz	Q8VZM2_ARATH Transcription elongation factor (TFIIS) family protein OS=Arabidopsis thaliana OX=3702 GN=At4g24200 PE=1 SV=1
4	AFDB:F4JCS8	0.156	0.095	1.101E-5	1613	0.163	0.095	F4JCS8.pdb.gz	F4JCS8_ARATH Protein SUO OS=Arabidopsis thaliana OX=3702 GN=SUO PE=1 SV=1
5	AFDB:Q9BYW2	0.119	0.046	6.574E-5	2564	0.121	0.044	Q9BYW2.pdb.gz	SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3
6	AFDB:O94913	0.056	0.036	2.049E-4	1555	0.199	0.120	O94913.pdb.gz	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
7	AFDB:Q961B0	0.131	0.117	2.102E-3	1067	0.112	0.098	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
8	AFDB:Q9V4F9	0.054	0.036	4.026E-3	1483	0.098	0.062	Q9V4F9.pdb.gz	MED26_DROME Mediator of RNA polymerase II transcription subunit 26 OS=Drosophila melanogaster OX=7227 GN=MED26 PE=1 SV=2
9	AFDB:Q6IMN6	0.055	0.049	7.709E-3	1127	0.138	0.115	Q6IMN6.pdb.gz	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
10	AFDB:Q05A80	0.060	0.055	9.574E-3	1031	0.136	0.124	Q05A80.pdb.gz	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1
11	PDB:7dvqK	0.124	0.522	3.091E-2	188	0.028	0.138	7dvqK.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:7cm7A	0.111	0.164	3.263E-2	620	0.030	0.045	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
13	PDB:7anwA	0.111	0.157	4.766E-2	645	0.029	0.042	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
14	PDB:6i7sG	0.089	0.096	8.646E-2	863	0.017	0.019	6i7sG.pdb.gz	The crystal structure of human microsomal triglyceride transfer protein.
15	PDB:7nscE	0.110	0.163	2.056E-1	615	0.021	0.033	7nscE.pdb.gz
16	PDB:4tnmA	0.109	0.235	2.291E-1	407	0.017	0.039	4tnmA.pdb.gz
17	PDB:7rroH7	0.093	0.139	2.291E-1	580	0.037	0.060	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:1qbkB	0.108	0.115	3.533E-1	880	0.022	0.024	1qbkB.pdb.gz	Structure of the nuclear transport complex karyopherin-beta2-Ran x GppNHp.
19	PDB:7pnt4	0.082	0.121	3.730E-1	589	0.021	0.034	7pnt4.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
20	PDB:3tpoA	0.102	0.204	3.937E-1	438	0.019	0.041	3tpoA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O55000	0.0	1099	872	0.779	0.839	PP1RA_RAT Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Rattus norvegicus OX=10116 GN=Ppp1r10 PE=1 SV=1
2	Q2L6I0	0.0	1845	940	1.000	1.000	Q2L6I0_HUMAN Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=2 SV=1
3	Q80W00	0.0	1084	888	0.791	0.838	PP1RA_MOUSE Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Mus musculus OX=10090 GN=Ppp1r10 PE=1 SV=1
4	Q96QC0	0.0	1845	940	1.000	1.000	PP1RA_HUMAN Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1
5	Q70HU3	2.29e-19	96.7	1135	0.057	0.048	Q70HU3_DROME PNUTSDm protein OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=2 SV=1
6	Q7KU01	2.29e-19	96.7	1135	0.057	0.048	Q7KU01_DROME Phosphatase 1 nuclear targeting subunit, isoform D OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=1 SV=1
7	Q9VPU9	9.40e-18	90.5	628	0.057	0.086	Q9VPU9_DROME Phosphatase 1 nuclear targeting subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=1 SV=2
8	Q70HU2	1.29e-17	90.1	630	0.057	0.086	Q70HU2_DROME PNUTSDm protein OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=2 SV=1
9	P79522	4.04e-12	68.2	188	0.030	0.149	PRR3_HUMAN Proline-rich protein 3 OS=Homo sapiens OX=9606 GN=PRR3 PE=1 SV=2
10	Q38796	1.03e-04	48.9	953	0.021	0.021	LUMI_ARATH Homeobox protein LUMINIDEPENDENS OS=Arabidopsis thaliana OX=3702 GN=LD PE=1 SV=2
11	Q960J4	4.59e-04	46.2	387	0.036	0.088	Q960J4_DROME LD47649p OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=2 SV=1
12	Q2UK72	0.029	40.8	765	0.041	0.051	PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pab1 PE=3 SV=1
13	Q68DN1	0.29	37.7	1984	0.041	0.020	CB016_HUMAN Uncharacterized protein C2orf16 OS=Homo sapiens OX=9606 GN=C2orf16 PE=2 SV=3
14	P33240	1.2	35.4	577	0.046	0.075	CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1
15	Q5B4N1	1.5	35.0	624	0.041	0.062	Q5B4N1_EMENI Nuclear pore complex protein An-Nsp1 (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04499 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08711 Med26	6.2e-05	34.3	TFIIS helical bundle-like domain
2	PF00642 zf-CCCH	0.16	23.2	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
3	PF14608 zf-CCCH_2	49	15.9	RNA-binding, Nab2-type zinc finger
4	PF18044 zf-CCCH_4	3.2	18.9	CCCH-type zinc finger
5	PF18345 zf_CCCH_4	9.9e+02	11.2	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365694

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326031	0.995	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
2	9606.ENSP00000296490	0.985	WD repeat-containing protein 82
3	9606.ENSP00000341779	0.985	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
4	9606.ENSP00000477868	0.984	TOX high mobility group box family member 4
5	9606.ENSP00000378769	0.972	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
6	9606.ENSP00000478767	0.912	Neurabin-2
7	9606.ENSP00000311677	0.860	Nuclear inhibitor of protein phosphatase 1
8	9606.ENSP00000200453	0.847	Protein phosphatase 1 regulatory subunit 15A
9	9606.ENSP00000308318	0.839	Protein phosphatase 1 regulatory subunit 3B
10	9606.ENSP00000360035	0.828	Protein phosphatase 1 regulatory subunit 3D
11	9606.ENSP00000389168	0.826	Protein phosphatase 1 regulatory subunit 12A
12	9606.ENSP00000328228	0.817	Cell division cycle-associated protein 2
13	9606.ENSP00000349124	0.804	Serine/threonine-protein phosphatase 4 regulatory subunit 2
14	9606.ENSP00000418447	0.803	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
15	9606.ENSP00000378306	0.794	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
16	9606.ENSP00000377036	0.793	Serine/threonine-protein phosphatase 2A activator
17	9606.ENSP00000378323	0.791	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
18	9606.ENSP00000383402	0.784	Serine/threonine-protein phosphatase 4 regulatory subunit 1
19	9606.ENSP00000221138	0.783	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
20	9606.ENSP00000356156	0.781	Protein phosphatase 1 regulatory subunit 15B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.884	heterocyclic compound binding
GO:0097159	0.884	organic cyclic compound binding
GO:0003676	0.869	nucleic acid binding
GO:0003723	0.590	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0048523	0.983	negative regulation of cellular process
GO:0009987	0.980	cellular process
GO:0048522	0.978	positive regulation of cellular process
GO:0019222	0.973	regulation of metabolic process
GO:0051128	0.960	regulation of cellular component organization
GO:0060255	0.935	regulation of macromolecule metabolic process
GO:0031323	0.930	regulation of cellular metabolic process
GO:0051171	0.927	regulation of nitrogen compound metabolic process
GO:0080090	0.926	regulation of primary metabolic process
GO:0048583	0.911	regulation of response to stimulus
GO:0019219	0.853	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.843	positive regulation of nitrogen compound metabolic process
GO:0031325	0.839	positive regulation of cellular metabolic process
GO:0010604	0.833	positive regulation of macromolecule metabolic process
GO:0023051	0.774	regulation of signaling
GO:0010646	0.774	regulation of cell communication
GO:0008152	0.623	metabolic process
GO:0009966	0.610	regulation of signal transduction
GO:0045935	0.595	positive regulation of nucleobase-containing compound metabolic process
GO:2001252	0.583	positive regulation of chromosome organization
GO:0071704	0.570	organic substance metabolic process
GO:0010656	0.561	negative regulation of muscle cell apoptotic process
GO:0032206	0.545	positive regulation of telomere maintenance
GO:1901976	0.523	regulation of cell cycle checkpoint
GO:0048585	0.515	negative regulation of response to stimulus
GO:0010667	0.514	negative regulation of cardiac muscle cell apoptotic process
GO:0080134	0.497	regulation of response to stress
GO:0009968	0.495	negative regulation of signal transduction
GO:0080135	0.478	regulation of cellular response to stress
GO:0043170	0.441	macromolecule metabolic process
GO:0051179	0.436	localization
GO:0033036	0.425	macromolecule localization
GO:0051641	0.416	cellular localization
GO:0051169	0.403	nuclear transport
GO:0090068	0.402	positive regulation of cell cycle process
GO:0044238	0.399	primary metabolic process
GO:0007346	0.396	regulation of mitotic cell cycle
GO:0006913	0.381	nucleocytoplasmic transport
GO:0006886	0.381	intracellular protein transport
GO:0045931	0.378	positive regulation of mitotic cell cycle
GO:1901989	0.378	positive regulation of cell cycle phase transition
GO:2001021	0.377	negative regulation of response to DNA damage stimulus
GO:0072594	0.370	establishment of protein localization to organelle
GO:1902532	0.349	negative regulation of intracellular signal transduction
GO:0010948	0.346	negative regulation of cell cycle process
GO:0006606	0.335	protein import into nucleus
GO:0006807	0.330	nitrogen compound metabolic process
GO:0009889	0.329	regulation of biosynthetic process
GO:0031326	0.324	regulation of cellular biosynthetic process
GO:0010468	0.315	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0005829	0.912	cytosol
GO:0032991	0.860	protein-containing complex
GO:0005694	0.656	chromosome
GO:0016604	0.565	nuclear body
GO:0008287	0.447	protein serine/threonine phosphatase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]