StarFunc result for job id Q96QE2

User Input

>input (648 residues)
MSRKASENVEYTLRSLSSLMGERRRKQPEPDAASAAGECSLLAAAESSTSLQSAGAGGGG
VGDLERAARRQFQQDETPAFVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQ
ELLVSSTVGAAAVSALAGGALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLV
VGLGIGIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRY
MLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIE
EEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDD
RLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSP
RITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAW
GRCENETKFKTEDIFWAYNFCPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWA
RSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGK
KLEEIESLFDNRLCTCGTSDSDEGRYIEYIRVKGSNYHLSDNDASDVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96QE2	1.000	1.000	3.871E-86	648	1.000	1.000	Q96QE2.pdb.gz	MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens OX=9606 GN=SLC2A13 PE=1 SV=3
2	AFDB:Q3UHK1	0.884	0.899	8.485E-76	637	0.869	0.884	Q3UHK1.pdb.gz	MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus OX=10090 GN=Slc2a13 PE=1 SV=2
3	AFDB:X1WEW2	0.816	0.888	1.629E-58	593	0.625	0.683	X1WEW2.pdb.gz
4	AFDB:C3RUD8	0.705	0.825	5.191E-46	546	0.554	0.658	C3RUD8.pdb.gz	C3RUD8_DANRE Glucose transporter 13a OS=Danio rerio OX=7955 GN=slc2a13a PE=2 SV=1
5	AFDB:Q21455	0.790	0.846	5.843E-39	604	0.363	0.389	Q21455.pdb.gz	HMT13_CAEEL Proton myo-inositol cotransporter hmit-1.3 OS=Caenorhabditis elegans OX=6239 GN=hmit-1.3 PE=2 SV=3
6	AFDB:Q9XXR3	0.737	0.785	7.816E-37	606	0.346	0.370	Q9XXR3.pdb.gz	HMT11_CAEEL Proton myo-inositol cotransporter hmit-1.1 OS=Caenorhabditis elegans OX=6239 GN=hmit-1.1 PE=2 SV=1
7	AFDB:Q9XXQ9	0.798	0.842	2.320E-36	613	0.326	0.344	Q9XXQ9.pdb.gz	HMT12_CAEEL Proton myo-inositol cotransporter hmit-1.2 OS=Caenorhabditis elegans OX=6239 GN=hmit-1.2 PE=2 SV=1
8	AFDB:O23492	0.775	0.860	9.221E-35	582	0.319	0.356	O23492.pdb.gz	INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana OX=3702 GN=INT4 PE=1 SV=1
9	AFDB:Q9C757	0.721	0.798	6.314E-33	580	0.330	0.369	Q9C757.pdb.gz	INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana OX=3702 GN=INT2 PE=1 SV=1
10	AFDB:Q8VZR6	0.679	0.860	3.814E-31	509	0.312	0.397	Q8VZR6.pdb.gz	INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana OX=3702 GN=INT1 PE=1 SV=1
11	PDB:7wsmA	0.631	0.872	1.155E-20	464	0.210	0.293	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
12	PDB:7sptA	0.598	0.802	1.256E-20	470	0.202	0.279	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
13	PDB:6thaA	0.620	0.885	1.614E-20	448	0.190	0.275	6thaA.pdb.gz
14	PDB:4gbyA	0.577	0.766	3.575E-20	475	0.213	0.291	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
15	PDB:7aaqA	0.587	0.761	4.226E-20	487	0.216	0.287	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
16	PDB:4ja4A	0.571	0.825	7.584E-19	442	0.211	0.310	4ja4A.pdb.gz
17	PDB:4ybqB	0.583	0.790	2.345E-17	462	0.205	0.288	4ybqB.pdb.gz
18	PDB:7zh0A	0.470	0.593	7.206E-10	495	0.139	0.182	7zh0A.pdb.gz
19	PDB:5oxpA	0.492	0.665	1.965E-8	462	0.110	0.154	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
20	PDB:6fmrA	0.479	0.633	2.526E-8	475	0.108	0.147	6fmrA.pdb.gz	In situ serial crystallography for rapid de novo membrane protein structure determination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C3RUD8	0.0	727	546	0.557	0.661	C3RUD8_DANRE Glucose transporter 13a OS=Danio rerio OX=7955 GN=slc2a13a PE=2 SV=1
2	Q3UHK1	0.0	1132	637	0.884	0.900	MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus OX=10090 GN=Slc2a13 PE=1 SV=2
3	Q921A2	0.0	1148	637	0.895	0.911	MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus OX=10116 GN=Slc2a13 PE=1 SV=2
4	Q96QE2	0.0	1326	648	1.000	1.000	MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens OX=9606 GN=SLC2A13 PE=1 SV=3
5	Q21455	8.66e-140	422	604	0.389	0.417	HMT13_CAEEL Proton myo-inositol cotransporter hmit-1.3 OS=Caenorhabditis elegans OX=6239 GN=hmit-1.3 PE=2 SV=3
6	Q9XXR3	9.31e-131	399	606	0.343	0.366	HMT11_CAEEL Proton myo-inositol cotransporter hmit-1.1 OS=Caenorhabditis elegans OX=6239 GN=hmit-1.1 PE=2 SV=1
7	Q9C757	9.90e-122	375	580	0.335	0.374	INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana OX=3702 GN=INT2 PE=1 SV=1
8	Q9XXQ9	4.62e-120	372	613	0.330	0.349	HMT12_CAEEL Proton myo-inositol cotransporter hmit-1.2 OS=Caenorhabditis elegans OX=6239 GN=hmit-1.2 PE=2 SV=1
9	O23492	6.94e-111	347	582	0.336	0.375	INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana OX=3702 GN=INT4 PE=1 SV=1
10	Q8VZR6	8.39e-75	250	509	0.224	0.285	INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana OX=3702 GN=INT1 PE=1 SV=1
11	Q8TD20	2.43e-70	241	617	0.264	0.277	GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens OX=9606 GN=SLC2A12 PE=2 SV=1
12	Q8BFW9	5.96e-70	240	622	0.255	0.265	GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus OX=10090 GN=Slc2a12 PE=2 SV=1
13	Q4QAR5	1.15e-66	230	547	0.205	0.243	Q4QAR5_LEIMA Myo-inositol/proton symporter (MIT) OS=Leishmania major OX=5664 GN=LMJF_24_0680 PE=3 SV=1
14	P30606	2.90e-66	230	609	0.185	0.197	ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ITR2 PE=1 SV=2
15	P87110	1.04e-64	225	557	0.193	0.224	ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=itr2 PE=2 SV=1
16	A0A1D8PH98	2.55e-63	221	554	0.193	0.226	ITR1_CANAL Myo-inositol transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ITR1 PE=1 SV=1
17	Q385N3	2.70e-63	219	483	0.207	0.277	Q385N3_TRYB2 Sugar transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3020 PE=3 SV=1
18	Q8VZ80	1.03e-58	208	539	0.248	0.299	PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana OX=3702 GN=PLT5 PE=1 SV=2
19	P30605	1.30e-58	209	584	0.174	0.193	ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ITR1 PE=1 SV=2
20	Q10286	9.78e-58	206	575	0.205	0.231	ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=itr1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	1.1e-23	95.4	Major Facilitator Superfamily
2	PF09176 Mpt_N	4.2e+02	12.5	Methylene-tetrahydromethanopterin dehydrogenase, N-terminal
3	PF00083 Sugar_tr	1.5e-109	378.5	Sugar (and other) transporter
4	PF06609 TRI12	3.6	17.6	Fungal trichothecene efflux pump (TRI12)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280871

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337746	0.753	Inositol-3-phosphate synthase 1
2	9606.ENSP00000266534	0.737	Transmembrane protein 117
3	9606.ENSP00000415899	0.716	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs
4	9606.ENSP00000381666	0.715	Glucoside xylosyltransferase 1
5	9606.ENSP00000266529	0.714	Zinc finger CCHC-type and RNA binding motif containing 1
6	9606.ENSP00000370543	0.696	Sodium/myo-inositol cotransporter
7	9606.ENSP00000370430	0.694	Patatin-like phospholipase domain-containing protein 4
8	9606.ENSP00000378935	0.694	Periphilin-1
9	9606.ENSP00000396452	0.686	Pseudouridine-5'-phosphatase
10	9606.ENSP00000449428	0.679	Twinfilin-1
11	9606.ENSP00000408526	0.677	Inositol monophosphatase 1
12	9606.ENSP00000289932	0.670	Sodium/myo-inositol cotransporter 2
13	9606.ENSP00000229729	0.592	Choline transporter-like protein 4
14	9606.ENSP00000296387	0.576	Claudin-19
15	9606.ENSP00000420914	0.574	Peroxisomal multifunctional enzyme type 2
16	9606.ENSP00000255389	0.551	Phosphatidylethanolamine N-methyltransferase
17	9606.ENSP00000482609	0.551	Peroxisome assembly protein 12
18	9606.ENSP00000244289	0.547	Hormone-sensitive lipase
19	9606.ENSP00000241041	0.544	Peroxisomal membrane protein PEX16
20	9606.ENSP00000281828	0.544	phenylalanyl-tRNA synthetase beta subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005365	1.000	myo-inositol transmembrane transporter activity
GO:0019899	0.996	enzyme binding
GO:0002020	0.991	protease binding
GO:0015145	0.976	monosaccharide transmembrane transporter activity
GO:0015149	0.974	hexose transmembrane transporter activity
GO:0005355	0.961	glucose transmembrane transporter activity
GO:0022804	0.907	active transmembrane transporter activity
GO:0015291	0.895	secondary active transmembrane transporter activity
GO:0015318	0.839	inorganic molecular entity transmembrane transporter activity
GO:0015293	0.768	symporter activity
GO:0022853	0.736	active monoatomic ion transmembrane transporter activity
GO:0015294	0.729	solute:monoatomic cation symporter activity
GO:0022890	0.665	inorganic cation transmembrane transporter activity
GO:0015078	0.586	proton transmembrane transporter activity
GO:0015295	0.555	solute:proton symporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015850	0.995	organic hydroxy compound transport
GO:0065007	0.838	biological regulation
GO:0050789	0.828	regulation of biological process
GO:0019222	0.700	regulation of metabolic process
GO:0080090	0.662	regulation of primary metabolic process
GO:0060255	0.654	regulation of macromolecule metabolic process
GO:0009987	0.519	cellular process
GO:0051171	0.516	regulation of nitrogen compound metabolic process
GO:0051246	0.463	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane
GO:0043226	0.960	organelle
GO:0043227	0.952	membrane-bounded organelle
GO:0005737	0.871	cytoplasm
GO:0042995	0.789	cell projection
GO:0043231	0.756	intracellular membrane-bounded organelle
GO:0044297	0.705	cell body
GO:0031090	0.451	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]