StarFunc result for job id Q96QE3

User Input

>input (1844 residues)
MVGVLAMAAAAAPPPVKDCEIEPCKKRKKDDDTSTCKTITKYLSPLGKTRDRVFAPPKPS
NILDYFRKTSPTNEKTQLGKECKIKSPESVPVDSNKDCTTPLEMFSNVEFKKKRKRVNLS
HQLNNIKTENEAPIEISSDDSKEDYSLNNDFVESSTSVLRYKKQVEVLAENIQDTKSQPN
TMTSLQNSKKVNPKQGTTKNDFKKLRKRKCRDVVDLSESLPLAEELNLLKKDGKDTKQME
NTTSHANSRDNVTEAAQLNDSIITVSYEEFLKSHKENKVEEIPDSTMSICVPSETVDEIV
KSGYISESENSEISQQVRFKTVTVLAQVHPIPPKKTGKIPRIFLKQKQFEMENSLSDPEN
EQTVQKRKSNVVIQEEELELAVLEAGSSEAVKPKCTLEERQQFMKAFRQPASDALKNGVK
KSSDKQKDLNEKCLYEVGRDDNSKKIMENSGIQMVSKNGNLQLHTDKGSFLKEKNKKLKK
KNKKTLDTGAIPGKNREGNTQKKETTFFLKEKQYQNRMSLRQRKTEFFKSSTLFNNESLV
YEDIANDDLLKVSSLCNNNKLSRKTSIPVKDIKLTQSKAESEASLLNVSTPKSTRRSGRI
SSTPTTETIRGIDSDDVQDNSQLKASTQKAANLSEKHSLYTAELITVPFDSESPIRMKFT
RISTPKKSKKKSNKRSEKSEATDGGFTSQIRKASNTSKNISKAKQLIEKAKALHISRSKV
TEEIAIPLRRSSRHQTLPERKKLSETEDSVIIIDSSPTALKHPEKNQKKLQCLNDVLGKK
LNTSTKNVPGKMKVAPLFLVRKAQKAADPVPSFDESSQDTSEKSQDCDVQCKAKRDFLMS
GLPDLLKRQIAKKAAALDVYNAVSTSFQRVVHVQQKDDGCCLWHLKPPSCPLLTKFKELN
TKVIDLSKCGIALGEFSTLNSKLKSGNSAAVFMRTRKEFTEEVRNLLLEEIRWSNPEFSL
KKYFPLLLKKQIEHQVLSSECHSKQELEADVSHKETKRKLVEAENSKSKRKKPNEYSKNL
EKTNRKSEELSKRNNSSGIKLDSSKDSGTEDMLWTEKYQPQTASELIGNELAIKKLHSWL
KDWKRRAELEERQNLKGKRDEKHEDFSGGIDFKGSSDDEEESRLCNTVLITGPTGVGKTA
AVYACAQELGFKIFEVNASSQRSGRQILSQLKEATQSHQVDKQGVNSQKPCFFNSYYIGK
SPKKISSPKKVVTSPRKVPPPSPKSSGPKRALPPKTLANYFKVSPKPKNNEEIGMLLENN
KGIKNSFEQKQITQTKSTNATNSNVKDVGAEEPSRKNATSLILFEEVDVIFDEDAGFLNA
IKTFMATTKRPVILTTSDPTFSLMFDGCFEEIKFSTPSLLNVASYLQMICLTENFRTDVK
DFVTLLTANTCDIRKSILYLQFWIRSGGGVLEERPLTLYRGNSRNVQLVCSEHGLDNKIY
PKNTKKKRVDLPKCDSGCAETLFGLKNIFSPSEDLFSFLKHKITMKEEWHKFIQLLTEFQ
MRNVDFLYSNLEFILPLPVDTIPETKNFCGPSVTVDASAATKSMNCLARKHSEREQPLKK
SQKKKQKKTLVILDDSDLFDTDLDFPDQSISLSSVSSSSNAEESKTGDEESKARDKGNNP
ETKKSIPCPPKTTAGKKCSALVSHCLNSLSEFMDNMSFLDALLTDVREQNKYGRNDFSWT
NGKVTSGLCDEFSLESNDGWTSQSSGELKAAAEALSFTKCSSAISKALETLNSCKKLGRD
PTNDLTFYVSQKRNNVYFSQSAANLDNAWKRISVIKSVFSSRSLLYVGNRQASIIEYLPT
LRNICKTEKLKEQGKSKRRFLHYFEGIHLDIPKETVNTLAADFP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4QY64	0.522	0.527	0.000	1826	0.690	0.697	Q4QY64.pdb.gz	ATAD5_MOUSE ATPase family AAA domain-containing protein 5 OS=Mus musculus OX=10090 GN=Atad5 PE=1 SV=1
2	AFDB:Q96QE3	1.000	1.000	0.000	1844	1.000	1.000	Q96QE3.pdb.gz	ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5 PE=1 SV=4
3	PDB:8dr5A	0.126	0.314	5.239E-12	646	0.058	0.166	8dr5A.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
4	PDB:7tfkA	0.094	0.448	5.460E-8	360	0.034	0.172	7tfkA.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
5	PDB:7tfhB	0.100	0.538	8.806E-7	320	0.029	0.166	7tfhB.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
6	AFDB:H2KYH3	0.037	0.036	4.285E-6	2476	0.129	0.096	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
7	AFDB:Q8I398	0.049	0.045	7.860E-6	2112	0.124	0.108	Q8I398.pdb.gz	Q8I398_PLAF7 Nucleoporin NUP221, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905100 PE=4 SV=1
8	PDB:7z6hK	0.101	0.375	9.969E-6	439	0.039	0.162	7z6hK.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
9	PDB:8dqxC	0.099	0.501	1.284E-5	330	0.025	0.139	8dqxC.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
10	PDB:6vvoB	0.099	0.537	3.711E-5	316	0.026	0.152	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
11	PDB:8dr0D	0.096	0.468	1.313E-4	344	0.027	0.145	8dr0D.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
12	AFDB:P29617	0.043	0.044	1.552E-4	1703	0.124	0.134	P29617.pdb.gz	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
13	PDB:7z6hD	0.093	0.489	1.779E-4	324	0.029	0.164	7z6hD.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
14	PDB:7z6hG	0.114	0.550	1.871E-4	317	0.031	0.183	7z6hG.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
15	AFDB:Q8INM3	0.037	0.044	1.900E-4	1420	0.118	0.154	Q8INM3.pdb.gz	SLE_DROME Protein slender lobes OS=Drosophila melanogaster OX=7227 GN=sle PE=1 SV=1
16	AFDB:Q8IRB5	0.038	0.042	2.325E-4	1465	0.127	0.160	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
17	PDB:8dqwE	0.106	0.474	7.326E-4	354	0.029	0.153	8dqwE.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
18	AFDB:O46048	0.041	0.035	9.105E-4	2342	0.126	0.099	O46048.pdb.gz	O46048_DROME EG:133E12.4 protein OS=Drosophila melanogaster OX=7227 GN=east PE=1 SV=1
19	AFDB:Q38FP7	0.046	0.053	1.848E-3	1378	0.102	0.136	Q38FP7.pdb.gz	Q38FP7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1400 PE=4 SV=1
20	AFDB:F4JP43	0.035	0.034	2.150E-3	2037	0.117	0.106	F4JP43.pdb.gz	F4JP43_ARATH G2484-1 protein OS=Arabidopsis thaliana OX=3702 GN=G2484-1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4QY64	0.0	2321	1826	0.690	0.697	ATAD5_MOUSE ATPase family AAA domain-containing protein 5 OS=Mus musculus OX=10090 GN=Atad5 PE=1 SV=1
2	Q96QE3	0.0	3776	1844	1.000	1.000	ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5 PE=1 SV=4
3	Q86BP6	1.01e-17	92.4	1162	0.026	0.041	ELG1_DROME Enhanced level of genomic instability 1 OS=Drosophila melanogaster OX=7227 GN=elg1 PE=1 SV=1
4	P38630	7.93e-12	73.2	861	0.031	0.067	RFC1_YEAST Replication factor C subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC1 PE=1 SV=1
5	O43086	5.04e-11	70.5	920	0.024	0.048	ELG1_SCHPO Telomere length regulation protein elg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elg1 PE=1 SV=1
6	Q4GZ30	9.95e-11	69.7	1174	0.036	0.057	Q4GZ30_TRYB2 AAA+ ATPase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1890 PE=4 SV=1
7	O60182	1.01e-10	69.3	934	0.023	0.045	RFC1_SCHPO Replication factor C subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc1 PE=1 SV=1
8	P35251	1.14e-10	69.3	1148	0.028	0.044	RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1 PE=1 SV=4
9	P49956	2.38e-09	64.7	741	0.019	0.047	CTF18_YEAST Chromosome transmission fidelity protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTF18 PE=1 SV=1
10	Q9USQ1	5.46e-09	63.9	960	0.020	0.039	CTF18_SCHPO Chromosome transmission fidelity protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ctf18 PE=1 SV=1
11	Q9C587	1.71e-08	62.4	956	0.020	0.038	RFC1_ARATH Replication factor C subunit 1 OS=Arabidopsis thaliana OX=3702 GN=RFC1 PE=2 SV=1
12	D3ZFT1	2.02e-08	62.0	1145	0.021	0.033	D3ZFT1_RAT Replication factor C subunit 1 OS=Rattus norvegicus OX=10116 GN=Rfc1 PE=1 SV=3
13	Q9Z2R7	2.62e-08	61.6	1104	0.021	0.034	Q9Z2R7_RAT Replication factor C subunit 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rfc1 PE=2 SV=1
14	A0A0G2JVK8	2.77e-08	61.6	1127	0.020	0.033	A0A0G2JVK8_RAT Replication factor C subunit 1 OS=Rattus norvegicus OX=10116 GN=Rfc1 PE=1 SV=2
15	P35601	3.23e-08	61.2	1131	0.021	0.034	RFC1_MOUSE Replication factor C subunit 1 OS=Mus musculus OX=10090 GN=Rfc1 PE=1 SV=2
16	P35600	5.58e-06	53.9	986	0.019	0.035	RFC1_DROME Replication factor C subunit 1 OS=Drosophila melanogaster OX=7227 GN=Gnf1 PE=1 SV=2
17	Q57Y55	3.68e-05	51.2	993	0.019	0.035	Q57Y55_TRYB2 AAA+ ATPase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.550 PE=4 SV=1
18	Q8IQ05	7.75e-05	50.4	993	0.023	0.042	CTF18_DROME Chromosome transmission fidelity protein 18 homolog OS=Drosophila melanogaster OX=7227 GN=cutlet PE=2 SV=2
19	Q12050	1.74e-04	48.9	791	0.020	0.047	ELG1_YEAST Telomere length regulation protein ELG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ELG1 PE=1 SV=1
20	O75943	4.61e-04	47.8	681	0.021	0.056	RAD17_HUMAN Cell cycle checkpoint protein RAD17 OS=Homo sapiens OX=9606 GN=RAD17 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	8.1e-05	34.5	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	63	15.0	AAA domain
3	PF13191 AAA_16	4.2	19.2	AAA ATPase domain
4	PF13401 AAA_22	0.28	22.9	AAA domain
5	PF07728 AAA_5	3.4e+02	12.6	AAA domain (dynein-related subfamily)
6	PF12775 AAA_7	28	15.7	P-loop containing dynein motor region
7	PF03266 NTPase_1	45	15.4	NTPase
8	PF03215 Rad17	30	16.0	Rad17 P-loop domain
9	PF01090 Ribosomal_S19e	53	15.0	Ribosomal protein S19e
10	PF00437 T2SSE	92	13.5	Type II/IV secretion system protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313171

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000055077	0.999	Replication factor C subunit 2
2	9606.ENSP00000376272	0.999	Replication factor C subunit 4
3	9606.ENSP00000408295	0.993	Replication factor C subunit 5
4	9606.ENSP00000307491	0.992	WD repeat-containing protein 48
5	9606.ENSP00000369411	0.990	Replication factor C subunit 3
6	9606.ENSP00000343526	0.986	Ubiquitin carboxyl-terminal hydrolase 1
7	9606.ENSP00000426191	0.982	Cell cycle checkpoint protein RAD17
8	9606.ENSP00000371321	0.962	Replication factor C subunit 1
9	9606.ENSP00000263377	0.959	Bromodomain-containing protein 4
10	9606.ENSP00000368458	0.957	Proliferating cell nuclear antigen
11	9606.ENSP00000353793	0.950	WD repeat and HMG-box DNA-binding protein 1
12	9606.ENSP00000351284	0.942	DNA repair protein RAD52 homolog
13	9606.ENSP00000305480	0.891	Flap endonuclease 1
14	9606.ENSP00000322180	0.879	Sister chromatid cohesion protein DCC1
15	9606.ENSP00000286398	0.864	Structural maintenance of chromosomes protein 2
16	9606.ENSP00000372023	0.863	Serine/threonine-protein kinase Chk2
17	9606.ENSP00000354720	0.860	Structural maintenance of chromosomes protein 3
18	9606.ENSP00000322570	0.854	DNA polymerase epsilon catalytic subunit A
19	9606.ENSP00000372088	0.840	DNA repair protein RAD51 homolog 1
20	9606.ENSP00000262315	0.836	Chromosome transmission fidelity protein 18 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008094	1.000	ATP-dependent activity, acting on DNA
GO:0061860	0.979	DNA clamp unloader activity
GO:1901363	0.635	heterocyclic compound binding
GO:0097159	0.635	organic cyclic compound binding
GO:0003676	0.622	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0019222	0.964	regulation of metabolic process
GO:0060255	0.950	regulation of macromolecule metabolic process
GO:0051171	0.942	regulation of nitrogen compound metabolic process
GO:0080090	0.941	regulation of primary metabolic process
GO:0006275	0.928	regulation of DNA replication
GO:0048522	0.912	positive regulation of cellular process
GO:0010604	0.887	positive regulation of macromolecule metabolic process
GO:0051173	0.886	positive regulation of nitrogen compound metabolic process
GO:0051054	0.883	positive regulation of DNA metabolic process
GO:0071704	0.868	organic substance metabolic process
GO:1902749	0.867	regulation of cell cycle G2/M phase transition
GO:0044238	0.860	primary metabolic process
GO:0009987	0.856	cellular process
GO:0006807	0.841	nitrogen compound metabolic process
GO:1901989	0.826	positive regulation of cell cycle phase transition
GO:0043170	0.817	macromolecule metabolic process
GO:0044237	0.804	cellular metabolic process
GO:0045740	0.738	positive regulation of DNA replication
GO:1902751	0.697	positive regulation of cell cycle G2/M phase transition
GO:0050896	0.661	response to stimulus
GO:0044260	0.622	cellular macromolecule metabolic process
GO:0051716	0.609	cellular response to stimulus
GO:0034641	0.574	cellular nitrogen compound metabolic process
GO:0090304	0.558	nucleic acid metabolic process
GO:0006259	0.504	DNA metabolic process
GO:0033554	0.491	cellular response to stress
GO:0006974	0.443	cellular response to DNA damage stimulus
GO:0048519	0.362	negative regulation of biological process
GO:0048523	0.353	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005694	0.999	chromosome
GO:0005634	0.986	nucleus
GO:0031981	0.974	nuclear lumen
GO:1902494	0.963	catalytic complex
GO:0005654	0.955	nucleoplasm
GO:0005737	0.658	cytoplasm
GO:0031391	0.582	Elg1 RFC-like complex
GO:0000785	0.466	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]