StarFunc result for job id Q96QG7

User Input

>input (549 residues)
MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDK
RFVGSLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVI
EDGWHSFLPEQEFELYSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKVATFR
HGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLN
VAQQTRAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIKLVEACNDQTHNMDRWLSKLE
ASNWLTHIKEILTTACLAAQCIDREGASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRG
FEALIEREWLQAGHPFQQRCAQSAYCNTKQKWEAPVFLLFLDCVWQILRQFPCSFEFNEN
FLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNQPSELSKFTNPLFEANNL
VIWPSVAPQSLPLWEGIFLRWNRSSKYLDEAYEEMVNIIEYNKELQAKVNILRRQLAELE
TEDGMQESP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96QG7	1.000	1.000	0.000	549	1.000	1.000	Q96QG7.pdb.gz	MTMR9_HUMAN Myotubularin-related protein 9 OS=Homo sapiens OX=9606 GN=MTMR9 PE=1 SV=1
2	AFDB:Q965W9	0.944	0.912	1.158E-63	569	0.441	0.425	Q965W9.pdb.gz	MTMR9_CAEEL Myotubularin-related protein 9 OS=Caenorhabditis elegans OX=6239 GN=mtm-9 PE=1 SV=1
3	AFDB:Q9Y216	0.865	0.725	7.263E-52	660	0.361	0.300	Q9Y216.pdb.gz	MTMR7_HUMAN Myotubularin-related protein 7 OS=Homo sapiens OX=9606 GN=MTMR7 PE=1 SV=3
4	AFDB:Q96EF0	0.855	0.673	5.870E-51	704	0.333	0.260	Q96EF0.pdb.gz	MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens OX=9606 GN=MTMR8 PE=1 SV=1
5	AFDB:Q9Y217	0.900	0.801	1.220E-50	621	0.342	0.303	Q9Y217.pdb.gz	MTMR6_HUMAN Myotubularin-related protein 6 OS=Homo sapiens OX=9606 GN=MTMR6 PE=1 SV=3
6	AFDB:Q6TEL0	0.869	0.759	2.056E-50	632	0.353	0.307	Q6TEL0.pdb.gz	MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio OX=7955 GN=mtmr8 PE=2 SV=1
7	AFDB:Q8MLR7	0.850	0.623	2.048E-49	761	0.344	0.248	Q8MLR7.pdb.gz	Q8MLR7_DROME Phosphatidylinositol-3-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Mtmr6 PE=1 SV=1
8	AFDB:Q9Z2C4	0.877	0.727	2.649E-48	669	0.361	0.296	Q9Z2C4.pdb.gz	MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus OX=10090 GN=Mtmr1 PE=1 SV=1
9	AFDB:Q13614	0.858	0.738	6.438E-48	643	0.364	0.311	Q13614.pdb.gz	MTMR2_HUMAN Myotubularin-related protein 2 OS=Homo sapiens OX=9606 GN=MTMR2 PE=1 SV=4
10	AFDB:O13819	0.819	0.805	1.404E-46	559	0.311	0.306	O13819.pdb.gz	YMR1_SCHPO Phosphoinositide 3-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC19A8.03 PE=3 SV=1
11	PDB:1lw3A	0.831	0.887	1.656E-46	513	0.344	0.368	1lw3A.pdb.gz
12	PDB:3pvuA	0.131	0.119	1.255E-3	609	0.013	0.011	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
13	PDB:7o4i1	0.135	0.142	1.630E-3	522	0.027	0.029	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:7nkyQ	0.122	0.163	1.717E-3	404	0.027	0.037	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
15	PDB:4mk0A	0.134	0.118	2.230E-3	631	0.015	0.013	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:3uzsA	0.141	0.128	2.895E-3	609	0.018	0.016	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
17	PDB:5yqrA	0.139	0.267	3.214E-3	268	0.031	0.063	5yqrA.pdb.gz
18	PDB:7r03B	0.141	0.043	3.759E-3	2246	0.126	0.031	7r03B.pdb.gz
19	PDB:6xtbE	0.144	0.310	4.882E-3	235	0.027	0.064	6xtbE.pdb.gz
20	PDB:1q67B	0.144	0.437	6.339E-3	161	0.033	0.112	1q67B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96QG7	0.0	1145	549	1.000	1.000	MTMR9_HUMAN Myotubularin-related protein 9 OS=Homo sapiens OX=9606 GN=MTMR9 PE=1 SV=1
2	Q9Z2D0	0.0	1099	545	0.945	0.952	MTMR9_MOUSE Myotubularin-related protein 9 OS=Mus musculus OX=10090 GN=Mtmr9 PE=1 SV=2
3	Q965W9	1.26e-159	468	569	0.441	0.425	MTMR9_CAEEL Myotubularin-related protein 9 OS=Caenorhabditis elegans OX=6239 GN=mtm-9 PE=1 SV=1
4	Q6TEL0	6.57e-110	343	632	0.362	0.315	MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio OX=7955 GN=mtmr8 PE=2 SV=1
5	Q9Y216	2.46e-108	340	660	0.357	0.297	MTMR7_HUMAN Myotubularin-related protein 7 OS=Homo sapiens OX=9606 GN=MTMR7 PE=1 SV=3
6	D3ZA31	1.09e-107	335	571	0.362	0.349	D3ZA31_RAT Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr2 PE=1 SV=2
7	Q13614	1.25e-106	335	643	0.359	0.306	MTMR2_HUMAN Myotubularin-related protein 2 OS=Homo sapiens OX=9606 GN=MTMR2 PE=1 SV=4
8	Q9W1Q6	1.73e-106	336	689	0.353	0.282	Q9W1Q6_DROME Phosphatidylinositol-3-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Mtmr6 PE=1 SV=2
9	Q9Z2D1	3.67e-106	333	643	0.359	0.306	MTMR2_MOUSE Myotubularin-related protein 2 OS=Mus musculus OX=10090 GN=Mtmr2 PE=1 SV=3
10	Q9Z2C4	5.83e-106	334	669	0.361	0.296	MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus OX=10090 GN=Mtmr1 PE=1 SV=1
11	Q9Y217	4.88e-105	330	621	0.350	0.309	MTMR6_HUMAN Myotubularin-related protein 6 OS=Homo sapiens OX=9606 GN=MTMR6 PE=1 SV=3
12	Q8MLR7	1.01e-104	333	761	0.341	0.246	Q8MLR7_DROME Phosphatidylinositol-3-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Mtmr6 PE=1 SV=1
13	Q13613	3.36e-104	329	665	0.352	0.290	MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo sapiens OX=9606 GN=MTMR1 PE=1 SV=4
14	Q9Z2C9	1.30e-103	327	660	0.348	0.289	MTMR7_MOUSE Myotubularin-related protein 7 OS=Mus musculus OX=10090 GN=Mtmr7 PE=1 SV=2
15	Q96EF0	7.38e-103	327	704	0.346	0.270	MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens OX=9606 GN=MTMR8 PE=1 SV=1
16	Q7KK51	5.00e-98	312	639	0.317	0.272	Q7KK51_DROME Phosphatidylinositol-3-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Mtmr6 PE=1 SV=1
17	Q9Z2C5	2.90e-95	304	603	0.328	0.299	MTM1_MOUSE Myotubularin OS=Mus musculus OX=10090 GN=Mtm1 PE=1 SV=2
18	Q13496	7.35e-94	300	603	0.322	0.294	MTM1_HUMAN Myotubularin OS=Homo sapiens OX=9606 GN=MTM1 PE=1 SV=2
19	Q32PM3	1.35e-91	295	639	0.326	0.280	Q32PM3_DANRE Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Danio rerio OX=7955 GN=zgc:123266 PE=1 SV=1
20	Q9VMI9	1.15e-88	287	619	0.273	0.242	Q9VMI9_DROME Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Drosophila melanogaster OX=7227 GN=mtm PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06602 Myotub-related	3e-128	439.4	Myotubularin-like phosphatase domain
2	PF15136 UPF0449	7.3e+02	12.0	Uncharacterised protein family UPF0449

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000221086

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000180173	0.979	Myotubularin-related protein 7
2	9606.ENSP00000371221	0.979	Myotubularin-related protein 6
3	9606.ENSP00000363985	0.978	Myotubularin-related protein 8
4	9606.ENSP00000369677	0.837	EMILIN-1
5	9606.ENSP00000284486	0.832	Protein FAM167A
6	9606.ENSP00000416707	0.801	XK-related protein 6
7	9606.ENSP00000259089	0.791	Tyrosine-protein kinase Blk
8	9606.ENSP00000182527	0.703	Translocating chain-associated membrane protein 2
9	9606.ENSP00000340839	0.638	Probable ribonuclease ZC3H12B
10	9606.ENSP00000350911	0.621	Cathepsin E
11	9606.ENSP00000480828	0.613	Squalene synthase
12	9606.ENSP00000318966	0.597	PIN2/TERF1-interacting telomerase inhibitor 1
13	9606.ENSP00000345752	0.589	Myotubularin-related protein 2
14	9606.ENSP00000246662	0.580	Keratin, type I cytoskeletal 9
15	9606.ENSP00000351008	0.535	Lebercilin-like protein
16	9606.ENSP00000262039	0.527	Phosphatidylinositol 3-kinase catalytic subunit type 3
17	9606.ENSP00000296003	0.518	Myotubularin-related protein 14
18	9606.ENSP00000311579	0.515	Tankyrase-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019902	0.995	phosphatase binding
GO:0098772	0.993	molecular function regulator activity
GO:0019903	0.883	protein phosphatase binding
GO:0030234	0.792	enzyme regulator activity
GO:0003824	0.784	catalytic activity
GO:0016787	0.667	hydrolase activity
GO:0052866	0.658	phosphatidylinositol phosphate phosphatase activity
GO:0004438	0.425	phosphatidylinositol-3-phosphate phosphatase activity
GO:0034593	0.377	phosphatidylinositol bisphosphate phosphatase activity
GO:0106018	0.345	phosphatidylinositol-3,5-bisphosphate phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.975	regulation of biological process
GO:0009987	0.959	cellular process
GO:0031323	0.947	regulation of cellular metabolic process
GO:0048519	0.932	negative regulation of biological process
GO:0048518	0.792	positive regulation of biological process
GO:0009894	0.782	regulation of catabolic process
GO:0048523	0.774	negative regulation of cellular process
GO:0080090	0.708	regulation of primary metabolic process
GO:0009892	0.686	negative regulation of metabolic process
GO:0065009	0.684	regulation of molecular function
GO:0031329	0.631	regulation of cellular catabolic process
GO:0048522	0.626	positive regulation of cellular process
GO:0035303	0.620	regulation of dephosphorylation
GO:0008152	0.602	metabolic process
GO:0031324	0.582	negative regulation of cellular metabolic process
GO:0031647	0.570	regulation of protein stability
GO:0019216	0.554	regulation of lipid metabolic process
GO:0071704	0.549	organic substance metabolic process
GO:0009895	0.507	negative regulation of catabolic process
GO:1903725	0.492	regulation of phospholipid metabolic process
GO:0031330	0.482	negative regulation of cellular catabolic process
GO:0050790	0.471	regulation of catalytic activity
GO:0044093	0.470	positive regulation of molecular function
GO:0044238	0.461	primary metabolic process
GO:0035306	0.450	positive regulation of dephosphorylation
GO:0051336	0.411	regulation of hydrolase activity
GO:0010921	0.402	regulation of phosphatase activity
GO:0051345	0.385	positive regulation of hydrolase activity
GO:0010506	0.346	regulation of autophagy
GO:0010922	0.339	positive regulation of phosphatase activity
GO:0044237	0.335	cellular metabolic process
GO:0050821	0.326	protein stabilization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.856	protein-containing complex
GO:0016020	0.350	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.667	Hydrolases.
EC:3.1.3.-	0.658	Phosphoric monoester hydrolases.
RHEA:12316	0.425	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + phosphate
EC:3.1.3.64	0.425	phosphatidylinositol-3-phosphatase.

[back to server]