StarFunc result for job id Q96QH2

User Input

>input (670 residues)
MAHHLPAAMESHQDFRSIKAKFQASQPEPSDLPKKPPKPEFGKLKKFSQPELSEHPKKAP
LPEFGAVSLKPPPPEVTDLPKKPPPPEVTDLPKKPPPPEVTDLPKKPPPPEVTDLPKKPS
KLELSDLSKKFPQLGATPFPRKPLQPEVGEAPLKASLPEPGAPARKPLQPDELSHPARPP
SEPKSGAFPRKLWQPEAGEATPRSPQPELSTFPKKPAQPEFNVYPKKPPQPQVGGLPKKS
VPQPEFSEAAQTPLWKPQSSEPKRDSSAFPKKASQPPLSDFPKKPPQPELGDLTRTSSEP
EVSVLPKRPRPAEFKALSKKPPQPELGGLPRTSSEPEFNSLPRKLLQPERRGPPRKFSQP
EPSAVLKRHPQPEFFGDLPRKPPLPSSASESSLPAAVAGFSSRHPLSPGFGAAGTPRWRS
GGLVHSGGARPGLRPSHPPRRRPLPPASSLGHPPAKPPLPPGPVDMQSFRRPSAASIDLR
RTRSAAGLHFQDRQPEDIPQVPDEIYELYDDVEPRDDSSPSPKGRDEAPSVQQAARRPPQ
DPALRKEKDPQPQQLPPMDPKLLKQLRKAEKAEREFRKKFKFEGEIVVHTKMMIDPNAKT
RRGGGKHLGIRRGEILEVIEFTSNEEMLCRDPKGKYGYVPRTALLPLETEVYDDVDFCDP
LENQPLPLGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96QH2	0.999	0.999	1.182E-94	670	1.000	1.000	Q96QH2.pdb.gz	PRAM_HUMAN PML-RARA-regulated adapter molecule 1 OS=Homo sapiens OX=9606 GN=PRAM1 PE=1 SV=3
2	AFDB:Q6BCL1	0.277	0.275	9.753E-45	675	0.563	0.559	Q6BCL1.pdb.gz	PRAM_MOUSE PML-RARA-regulated adapter molecule 1 OS=Mus musculus OX=10090 GN=Pram1 PE=1 SV=2
3	AFDB:Q5VWT5	0.127	0.117	2.812E-8	728	0.210	0.194	Q5VWT5.pdb.gz	FYB2_HUMAN FYN-binding protein 2 OS=Homo sapiens OX=9606 GN=FYB2 PE=1 SV=1
4	PDB:3qwyA	0.084	0.321	2.459E-4	170	0.018	0.071	3qwyA.pdb.gz
5	PDB:2eyzA	0.096	0.185	1.127E-3	304	0.024	0.053	2eyzA.pdb.gz
6	PDB:2h8hA	0.079	0.116	2.495E-3	445	0.018	0.027	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
7	AFDB:A0A494C1M0	0.085	0.060	3.234E-3	1011	0.179	0.119	A0A494C1M0.pdb.gz	A0A494C1M0_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
8	PDB:1griA	0.063	0.191	3.966E-3	211	0.022	0.071	1griA.pdb.gz
9	PDB:1k9aB	0.080	0.120	4.527E-3	441	0.012	0.018	1k9aB.pdb.gz
10	PDB:2dybA	0.081	0.176	6.304E-3	298	0.018	0.040	2dybA.pdb.gz
11	PDB:7mixC	0.079	0.152	1.222E-2	324	0.018	0.037	7mixC.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
12	PDB:2lqnA	0.072	0.155	1.306E-2	303	0.028	0.063	2lqnA.pdb.gz
13	AFDB:Q13387	0.083	0.070	1.809E-2	824	0.169	0.137	Q13387.pdb.gz	JIP2_HUMAN C-Jun-amino-terminal kinase-interacting protein 2 OS=Homo sapiens OX=9606 GN=MAPK8IP2 PE=1 SV=2
14	PDB:6x5hA	0.081	0.111	2.370E-2	467	0.016	0.024	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
15	PDB:1k0xA	0.072	0.383	3.767E-2	108	0.013	0.083	1k0xA.pdb.gz
16	AFDB:A0A0U1RQE4	0.073	0.048	4.003E-2	1047	0.194	0.124	A0A0U1RQE4.pdb.gz	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
17	AFDB:A0A0S3NTN0	0.084	0.072	2.095E-1	784	0.157	0.134	A0A0S3NTN0.pdb.gz
18	AFDB:A0A0G2K7A5	0.050	0.050	4.637E-1	680	0.163	0.160	A0A0G2K7A5.pdb.gz	A0A0G2K7A5_RAT Collagen type X alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col10a1 PE=4 SV=1
19	AFDB:P0CB65	0.050	0.049	4.637E-1	574	0.131	0.153	P0CB65.pdb.gz	SRRM4_DANRE Serine/arginine repetitive matrix protein 4 OS=Danio rerio OX=7955 GN=srrm4 PE=2 SV=1
20	AFDB:O96433	0.052	0.034	7.372E-1	1097	0.179	0.109	O96433.pdb.gz	CCNT_DROME Cyclin-T OS=Drosophila melanogaster OX=7227 GN=CycT PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6BCL1	0.0	564	675	0.582	0.578	PRAM_MOUSE PML-RARA-regulated adapter molecule 1 OS=Mus musculus OX=10090 GN=Pram1 PE=1 SV=2
2	Q96QH2	0.0	1282	670	1.000	1.000	PRAM_HUMAN PML-RARA-regulated adapter molecule 1 OS=Homo sapiens OX=9606 GN=PRAM1 PE=1 SV=3
3	O35601	2.12e-15	82.4	819	0.054	0.044	FYB1_MOUSE FYN-binding protein 1 OS=Mus musculus OX=10090 GN=Fyb1 PE=1 SV=2
4	O15117	2.21e-15	82.4	783	0.054	0.046	FYB1_HUMAN FYN-binding protein 1 OS=Homo sapiens OX=9606 GN=FYB1 PE=1 SV=2
5	D3ZIE4	3.12e-15	82.0	830	0.054	0.043	FYB1_RAT FYN-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Fyb1 PE=1 SV=2
6	Q5VWT5	1.97e-07	56.6	728	0.045	0.041	FYB2_HUMAN FYN-binding protein 2 OS=Homo sapiens OX=9606 GN=FYB2 PE=1 SV=1
7	M9PCJ6	1.71e-04	47.8	18641	0.076	0.003	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	M9PC48	2.35e-04	47.4	18095	0.076	0.003	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9PB30	0.001	44.7	22949	0.073	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
10	M9PBZ0	0.001	44.7	22830	0.073	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	M9PC41	0.001	44.7	22743	0.073	0.002	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PC45	0.001	44.7	22300	0.073	0.002	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PEH5	0.001	44.7	20710	0.073	0.002	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9PEI1	0.001	44.7	21657	0.073	0.002	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PB31	0.003	43.5	20404	0.073	0.002	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	Q86VQ3	0.32	36.6	553	0.124	0.150	TXND2_HUMAN Thioredoxin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TXNDC2 PE=1 SV=4
17	Q9ULH1	0.90	35.4	1129	0.054	0.032	ASAP1_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ASAP1 PE=1 SV=4
18	Q3IHD2	2.2	33.9	1071	0.040	0.025	Q3IHD2_PSET1 Ribonuclease E OS=Pseudoalteromonas translucida (strain TAC 125) OX=326442 GN=rne PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14603 hSH3	5.8e-29	111.8	Helically-extended SH3 domain
2	PF07653 SH3_2	16	16.7	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000408342

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268058	0.956	Protein PML
2	9606.ENSP00000376077	0.920	Small ubiquitin-related modifier 1
3	9606.ENSP00000343023	0.919	Nuclear autoantigen Sp-100
4	9606.ENSP00000254066	0.853	Retinoic acid receptor alpha
5	9606.ENSP00000338171	0.774	Src kinase-associated phosphoprotein 1
6	9606.ENSP00000268712	0.761	Nuclear receptor corepressor 1
7	9606.ENSP00000384018	0.721	Nuclear receptor corepressor 2
8	9606.ENSP00000410083	0.661	Vezatin
9	9606.ENSP00000227163	0.587	Transcription factor PU.1
10	9606.ENSP00000005587	0.583	Src kinase-associated phosphoprotein 2
11	9606.ENSP00000340507	0.580	Transcription intermediary factor 1-alpha
12	9606.ENSP00000338157	0.556	Zinc finger and BTB domain-containing protein 16
13	9606.ENSP00000377504	0.553	Zinc finger protein 414
14	9606.ENSP00000320147	0.510	Histone-lysine N-methyltransferase EZH2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.999	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0051716	0.991	cellular response to stimulus
GO:0007154	0.988	cell communication
GO:0023052	0.982	signaling
GO:0007165	0.973	signal transduction
GO:0048583	0.924	regulation of response to stimulus
GO:0007166	0.897	cell surface receptor signaling pathway
GO:0051239	0.813	regulation of multicellular organismal process
GO:0032879	0.745	regulation of localization
GO:0002682	0.573	regulation of immune system process
GO:0051049	0.543	regulation of transport
GO:0050865	0.457	regulation of cell activation
GO:0002694	0.454	regulation of leukocyte activation
GO:0050776	0.404	regulation of immune response
GO:0002697	0.397	regulation of immune effector process
GO:0071840	0.383	cellular component organization or biogenesis
GO:0002703	0.363	regulation of leukocyte mediated immunity
GO:0060627	0.362	regulation of vesicle-mediated transport
GO:0048518	0.346	positive regulation of biological process
GO:0060255	0.345	regulation of macromolecule metabolic process
GO:0007229	0.342	integrin-mediated signaling pathway
GO:0048522	0.340	positive regulation of cellular process
GO:0043300	0.328	regulation of leukocyte degranulation
GO:0002886	0.326	regulation of myeloid leukocyte mediated immunity
GO:0016043	0.316	cellular component organization
GO:0010468	0.313	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.997	protein-containing complex
GO:0031981	0.972	nuclear lumen
GO:0005654	0.964	nucleoplasm
GO:0005829	0.955	cytosol
GO:0043232	0.915	intracellular non-membrane-bounded organelle
GO:0016020	0.853	membrane
GO:0071944	0.659	cell periphery
GO:0005886	0.439	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]